SitesBLAST
Comparing AZOBR_RS14955 AZOBR_RS14955 formate dehydrogenase subunit beta to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6vw7D Formate dehydrogenase fdsabg subcomplex fdsbg from c. Necator - nadh bound (see paper)
71% identity, 97% coverage: 5:511/521 of query aligns to 4:510/514 of 6vw7D
- binding flavin mononucleotide: G154 (= G155), G156 (= G157), K165 (= K166), N182 (= N183), E185 (= E186), G273 (= G274), E274 (= E275), E275 (= E276), N309 (= N310), N310 (= N311), S313 (= S314), A490 (= A491), M491 (= M492)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A158 (= A159), F160 (= F161), K165 (= K166), T168 (= T169), E275 (= E276), L295 (= L296)
- binding iron/sulfur cluster: V271 (≠ I272), V289 (= V290), S442 (= S443), C443 (= C444), G444 (= G445), K445 (= K446), C446 (= C447), C449 (= C450), L488 (= L489), C489 (= C490), M491 (= M492), G492 (= G493)
6tg9B Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
63% identity, 97% coverage: 8:511/521 of query aligns to 3:492/493 of 6tg9B
- binding flavin mononucleotide: G146 (= G155), R147 (= R156), G148 (= G157), N174 (= N183), D176 (= D185), E177 (= E186), Y254 (= Y271), G257 (= G274), E258 (= E275), N293 (= N310), N294 (= N311), S297 (= S314)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F152 (= F161), K157 (= K166), E258 (= E275), E259 (= E276), L279 (= L296), K466 (≠ T485), L470 (= L489)
- binding iron/sulfur cluster: S426 (= S443), C427 (= C444), G428 (= G445), T429 (≠ K446), C430 (= C447), C433 (= C450), L470 (= L489), C471 (= C490), G474 (= G493)
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
41% identity, 96% coverage: 14:511/521 of query aligns to 9:509/584 of 8oh5B
- binding fe2/s2 (inorganic) cluster: C10 (≠ A15), C41 (≠ S46), C45 (≠ L50)
- binding flavin mononucleotide: R154 (= R156), K164 (= K166), N181 (= N183), F269 (≠ Y271), E273 (= E275), E274 (= E276), I307 (≠ V309), N308 (= N310), N309 (= N311), G489 (≠ A491), L490 (≠ M492)
- binding nicotinamide-adenine-dinucleotide: G155 (= G157), G156 (= G158), F159 (= F161), F163 (≠ I165), E273 (= E275), E274 (= E276), K291 (= K293), F294 (≠ L296), G413 (= G415)
- binding iron/sulfur cluster: P288 (≠ V290), C442 (= C444), G443 (= G445), C445 (= C447), C448 (= C450), C488 (= C490), L490 (≠ M492), G491 (= G493)
- binding zinc ion: C425 (≠ D427)
Sites not aligning to the query:
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 512, 518, 523
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
45% identity, 79% coverage: 100:511/521 of query aligns to 144:555/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G157), N227 (= N183), E230 (= E186), N355 (= N311), G535 (≠ A491), L536 (≠ M492)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E276), R337 (≠ K293), R340 (≠ L296), T341 (≠ P297), N342 (≠ A298), S433 (≠ L389)
- binding iron/sulfur cluster: S487 (= S443), C488 (= C444), G489 (= G445), C491 (= C447), C494 (= C450), C534 (= C490), L536 (≠ M492), G537 (= G493)
- binding zinc ion: C471 (≠ D427)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 558, 564
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
45% identity, 80% coverage: 103:519/521 of query aligns to 1:424/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ D427), C364 (≠ I465), H413 (vs. gap), C419 (≠ S514), A421 (= A516), C424 (≠ A519)
- binding flavin mononucleotide: G54 (= G155), G56 (= G157), K65 (= K166), N82 (= N183), D84 (= D185), E85 (= E186), G173 (= G274), E175 (= E276), N210 (= N311), G390 (≠ A491), L391 (≠ M492)
- binding nicotinamide-adenine-dinucleotide: G56 (= G157), G57 (= G158), A58 (= A159), F60 (= F161), K65 (= K166), F68 (≠ T169), E85 (= E186), E175 (= E276), R192 (≠ K293), F195 (≠ L296), I312 (≠ M413), M313 (≠ V414), S315 (≠ H416)
- binding iron/sulfur cluster: S342 (= S443), C343 (= C444), G344 (= G445), C346 (= C447), C349 (= C450), S387 (= S488), C389 (= C490), L391 (≠ M492), G392 (= G493)
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
45% identity, 80% coverage: 103:519/521 of query aligns to 1:424/425 of 7t2rB
- binding fe2/s2 (inorganic) cluster: C326 (≠ D427), D329 (≠ R430), C364 (≠ I465), H413 (vs. gap), C419 (≠ S514), A421 (= A516), C424 (≠ A519)
- binding iron/sulfur cluster: P189 (≠ V290), C343 (= C444), G344 (= G445), C346 (= C447), C349 (= C450), C389 (= C490), G392 (= G493)
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
40% identity, 96% coverage: 18:519/521 of query aligns to 18:538/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C48 (≠ S46), F49 (≠ R47), L51 (≠ M49), C52 (≠ L50)
- binding flavin mononucleotide: G166 (= G155), G168 (= G157), N196 (= N183), D198 (= D185), F284 (≠ Y271), G287 (= G274), E288 (= E275), E289 (= E276), N324 (= N311)
- binding iron/sulfur cluster: C457 (= C444), G458 (= G445), K459 (= K446), C460 (= C447), C463 (= C450), C503 (= C490), G506 (= G493)
- binding zinc ion: C440 (≠ D427), H527 (vs. gap), C533 (≠ S514)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
41% identity, 97% coverage: 7:511/521 of query aligns to 27:541/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C31 (≠ P11), G33 (≠ D13), T34 (≠ A14), C36 (≠ A16), C67 (≠ S46), C68 (≠ R47), G69 (= G48), R70 (≠ M49), C71 (≠ L50)
- binding flavin mononucleotide: G185 (= G155), R186 (= R156), G187 (= G157), N213 (= N183), D215 (= D185), E216 (= E186), G217 (= G187), F301 (≠ Y271), G304 (= G274), E305 (= E275), E306 (= E276), N340 (= N310), N341 (= N311), G521 (≠ A491), L522 (≠ M492)
- binding iron/sulfur cluster: P320 (≠ V290), S473 (= S443), C474 (= C444), G475 (= G445), K476 (= K446), C477 (= C447), C480 (= C450), L519 (= L489), C520 (= C490), L522 (≠ M492), G523 (= G493)
- binding zinc ion: C457 (≠ D427)
Sites not aligning to the query:
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
44% identity, 77% coverage: 120:519/521 of query aligns to 1:409/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G155), G39 (= G157), N67 (= N183), G158 (= G274), E159 (= E275), E160 (= E276), G375 (≠ A491)
- binding nicotinamide-adenine-dinucleotide: G40 (= G158), F43 (= F161), K48 (= K166), R177 (≠ K293), F180 (≠ L296), M297 (= M413)
- binding iron/sulfur cluster: S327 (= S443), C328 (= C444), G329 (= G445), K330 (= K446), C331 (= C447), C334 (= C450), L373 (= L489), C374 (= C490)
- binding zinc ion: C311 (≠ D427), H398 (vs. gap), C404 (≠ S514), C409 (≠ A519)
Sites not aligning to the query:
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
44% identity, 72% coverage: 143:519/521 of query aligns to 2:386/447 of 8a5eB
- binding flavin mononucleotide: G14 (= G155), G16 (= G157), N44 (= N183), G135 (= G274), E137 (= E276), N171 (= N310), N172 (= N311), G352 (≠ A491)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G157), G17 (= G158), F20 (= F161), K25 (= K166), F28 (≠ T169), D49 (= D188), R154 (≠ K293), F157 (≠ L296), S250 (≠ L389)
- binding iron/sulfur cluster: P151 (≠ V290), C305 (= C444), G306 (= G445), K307 (= K446), C308 (= C447), C311 (= C450), C351 (= C490), G354 (= G493)
- binding zinc ion: C288 (≠ D427), H375 (vs. gap), C381 (≠ S514), C386 (≠ A519)
Sites not aligning to the query:
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
41% identity, 78% coverage: 106:511/521 of query aligns to 13:420/437 of 4hea1
- binding flavin mononucleotide: G63 (= G155), K74 (= K166), N91 (= N183), D93 (= D185), Y179 (= Y271), G182 (= G274), E183 (= E275), N218 (= N310), N219 (= N311), L401 (≠ M492)
- binding iron/sulfur cluster: I180 (= I272), P198 (≠ V290), S351 (= S443), C352 (= C444), G353 (= G445), K354 (= K446), C355 (= C447), C358 (= C450), F398 (≠ L489), C399 (= C490), L401 (≠ M492)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
41% identity, 78% coverage: 106:511/521 of query aligns to 13:420/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G155), G65 (= G157), N91 (= N183), D93 (= D185), G182 (= G274), E183 (= E275), E184 (= E276), N218 (= N310), N219 (= N311), T222 (≠ S314), P400 (≠ A491)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G157), G66 (= G158), F69 (= F161), K74 (= K166), F77 (≠ T169), E96 (≠ D188), Y179 (= Y271), E184 (= E276), K201 (= K293), F204 (≠ L296), T324 (≠ H416)
- binding iron/sulfur cluster: S351 (= S443), C352 (= C444), K354 (= K446), C355 (= C447), C358 (= C450), F398 (≠ L489), C399 (= C490), L401 (≠ M492), A402 (≠ G493)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
41% identity, 78% coverage: 106:511/521 of query aligns to 14:421/438 of Q56222
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
40% identity, 76% coverage: 120:513/521 of query aligns to 29:415/419 of 6saqB
- binding flavin mononucleotide: G64 (= G155), G66 (= G157), K75 (= K166), N91 (= N183), D93 (= D185), E94 (= E186), Y179 (= Y271), G182 (= G274), E183 (= E275), N218 (= N310), N219 (= N311), T222 (≠ S314)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G157), G67 (= G158), A68 (= A159), F70 (= F161), K75 (= K166), E94 (= E186), E96 (≠ D188), T99 (= T191), E184 (= E276), Y204 (≠ L296), T318 (≠ H416)
- binding iron/sulfur cluster: P198 (≠ V290), T345 (≠ S443), C346 (= C444), G347 (= G445), Q348 (≠ K446), C349 (= C447), C352 (= C450), I391 (≠ L489), C392 (= C490), G395 (= G493)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
40% identity, 76% coverage: 120:513/521 of query aligns to 28:414/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G155), G65 (= G157), K74 (= K166), N90 (= N183), D92 (= D185), E93 (= E186), G181 (= G274), E182 (= E275), E183 (= E276), V216 (= V309), N217 (= N310), N218 (= N311), T221 (≠ S314)
- binding nicotinamide-adenine-dinucleotide: G65 (= G157), G66 (= G158), A67 (= A159), F69 (= F161), K74 (= K166), E95 (≠ D188), Y178 (= Y271), E183 (= E276), K200 (= K293), Y203 (≠ L296)
- binding iron/sulfur cluster: I179 (= I272), P197 (≠ V290), T344 (≠ S443), C345 (= C444), G346 (= G445), Q347 (≠ K446), C348 (= C447), C351 (= C450), S389 (= S488), I390 (≠ L489), C391 (= C490), L393 (≠ M492), G394 (= G493)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
40% identity, 76% coverage: 120:513/521 of query aligns to 29:415/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G155), G66 (= G157), K75 (= K166), N91 (= N183), D93 (= D185), E94 (= E186), G182 (= G274), E183 (= E275), E184 (= E276), V217 (= V309), N218 (= N310), N219 (= N311), T222 (≠ S314), G393 (≠ A491)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G157), G67 (= G158), A68 (= A159), F70 (= F161), K75 (= K166), E94 (= E186), E96 (≠ D188), Y179 (= Y271), E184 (= E276), Y204 (≠ L296)
- binding iron/sulfur cluster: P198 (≠ V290), T345 (≠ S443), C346 (= C444), G347 (= G445), Q348 (≠ K446), C349 (= C447), C352 (= C450), I391 (≠ L489), C392 (= C490), L394 (≠ M492), G395 (= G493)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
40% identity, 76% coverage: 120:513/521 of query aligns to 30:416/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G155), G67 (= G157), K76 (= K166), N92 (= N183), E95 (= E186), Y180 (= Y271), G183 (= G274), E184 (= E275), V218 (= V309), N219 (= N310), N220 (= N311), T223 (≠ S314)
- binding iron/sulfur cluster: T346 (≠ S443), C347 (= C444), G348 (= G445), Q349 (≠ K446), C350 (= C447), C353 (= C450), S391 (= S488), I392 (≠ L489), C393 (= C490), G396 (= G493)
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
40% identity, 76% coverage: 117:511/521 of query aligns to 22:419/442 of 7p61F
- binding flavin mononucleotide: G61 (= G155), G63 (= G157), K72 (= K166), N90 (= N183), D92 (= D185), G181 (= G274), E182 (= E275), N217 (= N310), N218 (= N311), A399 (= A491), H400 (≠ M492)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G157), G64 (= G158), A65 (= A159), F67 (= F161), K72 (= K166), L75 (≠ T169), E95 (≠ D188), Y178 (= Y271), E183 (= E276), F203 (≠ L296), R320 (≠ M413), T323 (≠ H416)
- binding iron/sulfur cluster: S350 (= S443), C351 (= C444), W353 (≠ K446), C354 (= C447), C357 (= C450), F397 (≠ L489), C398 (= C490), H400 (≠ M492)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
40% identity, 76% coverage: 117:511/521 of query aligns to 15:417/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G155), R54 (= R156), G55 (= G157), A57 (= A159), K64 (= K166), N90 (= N183), D92 (= D185), Y178 (= Y271), G181 (= G274), E182 (= E275), E183 (= E276), N217 (= N310), N218 (= N311), S221 (= S314), L398 (≠ M492)
- binding iron/sulfur cluster: P197 (≠ V290), S349 (= S443), C350 (= C444), G351 (= G445), K352 (= K446), C353 (= C447), C356 (= C450), S394 (= S488), F395 (≠ L489), C396 (= C490), L398 (≠ M492), G399 (= G493)
- binding zinc ion: C333 (≠ D427), E371 (≠ I465)
Sites not aligning to the query:
7v2cA Active state complex i from q10 dataset (see paper)
39% identity, 74% coverage: 123:509/521 of query aligns to 25:420/433 of 7v2cA
- binding flavin mononucleotide: G62 (= G155), K73 (= K166), N91 (= N183), Y179 (= Y271), G182 (= G274), E183 (= E275), N219 (= N311), A401 (= A491), L402 (≠ M492)
- binding iron/sulfur cluster: P198 (≠ V290), C354 (= C444), G355 (= G445), Q356 (≠ K446), C357 (= C447), C360 (= C450), T398 (≠ S488), C400 (= C490), L402 (≠ M492)
Query Sequence
>AZOBR_RS14955 AZOBR_RS14955 formate dehydrogenase subunit beta
MSEPLHTIYVPRDAAALSVGADETAAAIRAEATKRGIPLRIVRNGSRGMLWLETLVEVET
PEGRVAYGPVMAEDVAGLFDAGFLEGADHALAHGLTEKIPYFAKQERLTFARCGIIDPLS
VEDYRLHGGFRGLERALAMTPAEIVTEVTESGLRGRGGAGFPTGIKWNTVLNAKADQKYI
CCNADEGDSGTFADRMIMEGDPFCLIEGMTIAAIAVGATEGYIYIRSEYPHAVATMREAI
RLAYDEKWLGDEIHGTGHRFHLDVRVGAGAYICGEETSMLESLEGKRGTVRAKPPLPALE
GLFGKPTIVNNVLSLTSVPIILDKGANHYRDFGVGRSRGTLAFQLAGNIKHGGIVEKAFG
VTLHELLYEFGGGTITGRPIRAVQAGGPLGAYLPPSLFELPKDYEAFAAVEAMVGHGGIV
VFDDSVDMARQARFAMEFCAAESCGKCTPCRIGAVRGVEVMDNIIAGEKVQANITLLNDL
CEVMTDGSLCAMGGMTPIPVRSALKHFPEDFTRSPAAVAAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory