Comparing AZOBR_RS15685 FitnessBrowser__azobra:AZOBR_RS15685 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
37% identity, 83% coverage: 37:257/266 of query aligns to 3:226/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
36% identity, 83% coverage: 37:257/266 of query aligns to 3:224/225 of 4zv2A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
35% identity, 85% coverage: 30:256/266 of query aligns to 2:228/229 of 5t0wA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
34% identity, 86% coverage: 28:256/266 of query aligns to 1:231/247 of 2yjpA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
32% identity, 85% coverage: 31:256/266 of query aligns to 3:227/229 of 6svfA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
30% identity, 79% coverage: 29:239/266 of query aligns to 5:217/251 of 1xt8B
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
31% identity, 85% coverage: 31:255/266 of query aligns to 3:229/231 of 2v25A
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
30% identity, 83% coverage: 35:256/266 of query aligns to 10:234/243 of 5eyfB
5l9oB Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
30% identity, 83% coverage: 40:261/266 of query aligns to 13:236/243 of 5l9oB
5lomB Crystal structure of the pbp soca from agrobacterium tumefaciens c58 in complex with dfg at 1.5 a resolution (see paper)
30% identity, 83% coverage: 40:261/266 of query aligns to 14:237/250 of 5lomB
5l9oA Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
30% identity, 83% coverage: 40:261/266 of query aligns to 12:235/241 of 5l9oA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
26% identity, 83% coverage: 37:256/266 of query aligns to 3:226/234 of 3k4uE
7a99B Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp (see paper)
43% identity, 34% coverage: 31:121/266 of query aligns to 2:92/130 of 7a99B
Sites not aligning to the query:
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
24% identity, 87% coverage: 29:260/266 of query aligns to 4:234/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
24% identity, 87% coverage: 29:260/266 of query aligns to 8:238/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
24% identity, 87% coverage: 29:260/266 of query aligns to 8:238/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
24% identity, 87% coverage: 29:260/266 of query aligns to 8:238/241 of 3vvdA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
29% identity, 82% coverage: 38:256/266 of query aligns to 1:222/224 of 4ymxA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
26% identity, 85% coverage: 31:256/266 of query aligns to 45:272/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
26% identity, 85% coverage: 31:256/266 of query aligns to 44:271/287 of 6h20A
>AZOBR_RS15685 FitnessBrowser__azobra:AZOBR_RS15685
MTLSITRRLAVAGVMMAAAVALAVPAAAQTVDEIKSKGKLTIGMLVDFPPFGITTADGKP
DGYDADVAKLLGKHMGVPVEIVPVTGPNRIPYLLTNKVDLLVASLGITPARAEQVQFSEP
YAAIEIGLVAPANTKIKEAAELSGKRIGVARASTQDNALTAVAPKDARIMRFDDDASAVQ
AMLSGQVDALGLSNVVTKEIKKLAPQANYEMKFVLNRQVQGIAMRKGQDALLKWVNEFIE
TAKSNGELNEVHKKWLGTDLPPLTKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory