Comparing AZOBR_RS15705 FitnessBrowser__azobra:AZOBR_RS15705 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
2eb5A Crystal structure of hpcg complexed with oxalate (see paper)
27% identity, 91% coverage: 17:248/254 of query aligns to 14:253/259 of 2eb5A
2eb6A Crystal structure of hpcg complexed with mg ion (see paper)
25% identity, 91% coverage: 17:248/254 of query aligns to 14:261/267 of 2eb6A
P42270 2-oxo-hept-4-ene-1,7-dioate hydratase; OHED hydratase; EC 4.2.1.163 from Escherichia coli (see paper)
25% identity, 91% coverage: 17:248/254 of query aligns to 14:261/267 of P42270
>AZOBR_RS15705 FitnessBrowser__azobra:AZOBR_RS15705
MPDEMNNAAFSDSVDALIQARKNRDWLSALPTRPTSEAEAYAIQDAVARRLGPVVAWKVG
ARTPDTEPFRAPIHADTLFFDTTTLPAADYQVIGMEAEIAYKFAKDLPPRAEPYSREEVL
DAVESVHPAFEIVDTRFAGFGSQDGLSHMADQFNHGALVVGPAIADWRSLEPLKERVALV
VDGETKADTVAGNSAGEPVRLLVWMANTGAVSLGGLKAGDVVTTGSHVGTVMVPAGSTSV
AVYGTMGTYELTVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory