Comparing AZOBR_RS15725 FitnessBrowser__azobra:AZOBR_RS15725 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2w90B Geobacillus stearothermophilus 6-phosphogluconate dehydrogenase with bound 6- phosphogluconate (see paper)
51% identity, 99% coverage: 1:457/460 of query aligns to 8:469/471 of 2w90B
2iypA Product rup (see paper)
48% identity, 99% coverage: 1:457/460 of query aligns to 6:468/469 of 2iypA
2iypB Product rup (see paper)
48% identity, 99% coverage: 1:457/460 of query aligns to 7:469/470 of 2iypB
2iz1B 6pdh complexed with pex inhibitor synchrotron data (see paper)
48% identity, 99% coverage: 1:457/460 of query aligns to 8:470/471 of 2iz1B
2iyoA Structural characterization of a bacterial 6pdh reveals aspects of specificity, mechanism and mode of inhibition (see paper)
48% identity, 99% coverage: 1:457/460 of query aligns to 6:468/470 of 2iyoA
P96789 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Lactococcus lactis subsp. cremoris (strain MG1363) (see paper)
48% identity, 99% coverage: 1:457/460 of query aligns to 6:468/472 of P96789
7cb5B The 6-phosphogluconate dehydrogenase from staphylococcus aureus (6- phosphogluconate bound) (see paper)
48% identity, 99% coverage: 1:457/460 of query aligns to 5:465/467 of 7cb5B
7cb2A The 6-phosphogluconate dehydrogenase (NADP-bound) from staphylococcus aureus
48% identity, 99% coverage: 1:457/460 of query aligns to 5:465/466 of 7cb2A
P00350 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Escherichia coli (strain K12) (see paper)
47% identity, 99% coverage: 1:457/460 of query aligns to 6:466/468 of P00350
3fwnB Dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate (see paper)
47% identity, 99% coverage: 1:457/460 of query aligns to 5:465/467 of 3fwnB
3fwnA Dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate (see paper)
47% identity, 99% coverage: 1:457/460 of query aligns to 5:465/467 of 3fwnA
2zydA Dimeric 6-phosphogluconate dehydrogenase complexed with glucose (see paper)
47% identity, 99% coverage: 1:457/460 of query aligns to 4:464/464 of 2zydA
2p4qA Crystal structure analysis of gnd1 in saccharomyces cerevisiae (see paper)
48% identity, 97% coverage: 1:444/460 of query aligns to 5:454/476 of 2p4qA
P52209 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Homo sapiens (Human)
47% identity, 99% coverage: 1:457/460 of query aligns to 6:469/483 of P52209
Sites not aligning to the query:
2jkvA Structure of human phosphogluconate dehydrogenase in complex with NADPH at 2.53a
47% identity, 99% coverage: 1:457/460 of query aligns to 5:468/482 of 2jkvA
Sites not aligning to the query:
5uq9E Crystal structure of 6-phosphogluconate dehydrogenase with ((4r,5r)-5- (hydroxycarbamoyl)-2,2-dimethyl-1,3-dioxolan-4-yl)methyl dihydrogen phosphate (see paper)
47% identity, 99% coverage: 1:457/460 of query aligns to 5:468/468 of 5uq9E
1pgqA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
46% identity, 99% coverage: 1:457/460 of query aligns to 5:468/473 of 1pgqA
1pgpA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
46% identity, 99% coverage: 1:457/460 of query aligns to 5:468/473 of 1pgpA
1pgoA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
46% identity, 99% coverage: 1:457/460 of query aligns to 5:468/473 of 1pgoA
1pgnA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
46% identity, 99% coverage: 1:457/460 of query aligns to 5:468/473 of 1pgnA
>AZOBR_RS15725 FitnessBrowser__azobra:AZOBR_RS15725
IAVLGLGVMGRNLAANLADHGAVVAGYDLDEGRRGAFAAQVANAVPCASVEELLGALKAP
RTILMMVPAGAPVDELTAALLPRLSPGDVLIDGGNSHFRDTNRRAALAAAAGVRFVGLGV
SGGEEGARRGPALMAGGDAEALAPVAPLLAAIAARAPDGESCFARVGPEGAGHFVKMIHN
GIEYADMQLIAEAYHLLREIGGCSYERLADIFADWNSGELASYLMEITTDILRTKDGESG
APILEVIRDAAGQKGTGHWAATTALELGMPAPTIAEAVHARCLSALKDERVRAAEALAIP
HAPSTEDLVASVGDALLSGRIAVYAQGFAVIAAGSRQFGWDVDLAAVARIWRGGCIIRAR
LLDRILTALNRAPELPNLMLDPDIAGLMTRGDAGFRRVVAAATLAAVPVPAMASALSYWD
GYRSGRLWANMIQAQRDYFGAHGYERTDRPGMVHTEWKVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory