SitesBLAST
Comparing AZOBR_RS16015 FitnessBrowser__azobra:AZOBR_RS16015 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q20595 C-terminal-binding protein 1 from Caenorhabditis elegans (see paper)
33% identity, 91% coverage: 23:329/336 of query aligns to 191:495/727 of Q20595
- G332 (= G159) mutation to V: Does not rescue the extended lifespan phenotype observed in ctbp-1 deletion mutants.
- G334 (= G161) mutation to V: Does not rescue the extended lifespan phenotype observed in ctbp-1 deletion mutants.
- H467 (= H301) mutation to A: Rescues the extended lifespan phenotype observed in ctbp-1 deletion mutants.
4u6sA Ctbp1 in complex with substrate phenylpyruvate (see paper)
34% identity, 91% coverage: 23:329/336 of query aligns to 15:318/328 of 4u6sA
- active site: S99 (≠ G106), R241 (= R244), D265 (= D269), E270 (= E274), H290 (= H301)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V110), G156 (= G159), G158 (= G161), R159 (= R162), V160 (≠ I163), Y178 (= Y181), D179 (= D182), P180 (= P183), Y181 (≠ Q184), H211 (= H214), C212 (= C215), G213 (≠ P216), N218 (≠ T221), T239 (= T242), A240 (= A243), R241 (= R244), H290 (= H301), W293 (≠ F304)
- binding 3-phenylpyruvic acid: Y51 (≠ V58), H52 (≠ W59), I73 (≠ F80), G74 (= G81), S75 (≠ V82), G76 (= G83), R241 (= R244), W293 (≠ F304), M302 (= M313)
4u6qA Ctbp1 bound to inhibitor 2-(hydroxyimino)-3-phenylpropanoic acid (see paper)
34% identity, 91% coverage: 23:329/336 of query aligns to 15:318/328 of 4u6qA
- active site: S99 (≠ G106), R241 (= R244), D265 (= D269), E270 (= E274), H290 (= H301)
- binding (2E)-2-(hydroxyimino)-3-phenylpropanoic acid: Y51 (≠ V58), I73 (≠ F80), G74 (= G81), S75 (≠ V82), G76 (= G83), R241 (= R244), H290 (= H301), W293 (≠ F304), M302 (= M313)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S75 (≠ V82), T103 (≠ V110), G156 (= G159), R159 (= R162), V160 (≠ I163), Y178 (= Y181), D179 (= D182), P180 (= P183), Y181 (≠ Q184), H211 (= H214), C212 (= C215), G213 (≠ P216), N218 (≠ T221), T239 (= T242), A240 (= A243), R241 (= R244), H290 (= H301), W293 (≠ F304)
6v89A Human ctbp1 (28-375) in complex with amp (see paper)
34% identity, 91% coverage: 23:329/336 of query aligns to 15:318/332 of 6v89A
4lceA Ctbp1 in complex with substrate mtob (see paper)
34% identity, 91% coverage: 23:329/336 of query aligns to 14:317/327 of 4lceA
- active site: S98 (≠ G106), R240 (= R244), D264 (= D269), E269 (= E274), H289 (= H301)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: R71 (= R79), G73 (= G81), S74 (≠ V82), G75 (= G83), R240 (= R244), H289 (= H301), W292 (≠ F304)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ V82), T102 (≠ V110), G155 (= G159), G157 (= G161), R158 (= R162), V159 (≠ I163), Y177 (= Y181), D178 (= D182), P179 (= P183), Y180 (≠ Q184), H210 (= H214), C211 (= C215), N214 (≠ T218), N217 (≠ T221), T238 (= T242), A239 (= A243), R240 (= R244), W292 (≠ F304)
6cdfA Human ctbp1 (28-378) (see paper)
34% identity, 91% coverage: 23:329/336 of query aligns to 16:319/333 of 6cdfA
- binding 1,4-dihydronicotinamide adenine dinucleotide: T104 (≠ V110), G157 (= G159), R160 (= R162), V161 (≠ I163), Y179 (= Y181), D180 (= D182), P181 (= P183), Y182 (≠ Q184), H212 (= H214), C213 (= C215), N219 (≠ T221), T240 (= T242), A241 (= A243), R242 (= R244), H291 (= H301), W294 (≠ F304)
1hl3A Ctbp/bars in ternary complex with NAD(h) and pidlskk peptide (see paper)
34% identity, 91% coverage: 23:329/336 of query aligns to 15:318/331 of 1hl3A
- active site: S99 (≠ G106), R241 (= R244), D265 (= D269), E270 (= E274), H290 (= H301)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V110), G158 (= G161), R159 (= R162), V160 (≠ I163), D179 (= D182), Y181 (≠ Q184), H211 (= H214), C212 (= C215), G213 (≠ P216), N218 (≠ T221), T239 (= T242), A240 (= A243), R241 (= R244), D265 (= D269), H290 (= H301)
- binding : M17 (≠ A25), V26 (= V34), A27 (≠ D35), F28 (= F36), C29 (≠ L37), E36 (≠ D44), H38 (≠ D46), E39 (≠ P47)
Sites not aligning to the query:
1hkuA Ctbp/bars: a dual-function protein involved in transcription corepression and golgi membrane fission (see paper)
34% identity, 91% coverage: 23:329/336 of query aligns to 15:318/331 of 1hkuA
- active site: S99 (≠ G106), R241 (= R244), D265 (= D269), E270 (= E274), H290 (= H301)
- binding nicotinamide-adenine-dinucleotide: S75 (≠ V82), T103 (≠ V110), G156 (= G159), G158 (= G161), R159 (= R162), V160 (≠ I163), Y178 (= Y181), D179 (= D182), P180 (= P183), Y181 (≠ Q184), C212 (= C215), N218 (≠ T221), T239 (= T242), A240 (= A243), R241 (= R244), H290 (= H301), W293 (≠ F304)
Sites not aligning to the query:
Q9Z2F5 C-terminal-binding protein 1; CtBP1; 50 kDa BFA-dependent ADP-ribosylation substrate; BARS-50; C-terminal-binding protein 3; CtBP3; EC 1.1.1.- from Rattus norvegicus (Rat) (see 3 papers)
34% identity, 91% coverage: 23:329/336 of query aligns to 29:332/430 of Q9Z2F5
- A41 (≠ D35) mutation to E: Strongly reduces interaction with E1A.
- V55 (≠ R49) mutation to R: Strongly reduces interaction with E1A.
- S89 (≠ V82) binding
- IGLGRV 169:174 (≠ VGVGRI 158:163) binding
- G172 (= G161) mutation to E: Loss dimerization and of NAD binding.
- D193 (= D182) binding
- 226:232 (vs. 215:221, 29% identical) binding
- TAR 253:255 (= TAR 242:244) binding
- D279 (= D269) binding
Q13363 C-terminal-binding protein 1; CtBP1; EC 1.1.1.- from Homo sapiens (Human) (see 4 papers)
34% identity, 91% coverage: 23:329/336 of query aligns to 40:343/440 of Q13363
- A52 (≠ D35) mutation to E: Loss of interaction with SIMC1. No effect on its proteolytic processing mediated by CAPN3.
- V66 (≠ R49) mutation to R: Loss of interaction with SIMC1. Reduced proteolytic processing mediated by CAPN3.
- C134 (≠ S116) mutation to A: Strongly reduces E1A binding; when associated with A-138; A-141 and A-150.
- N138 (≠ S120) mutation to A: Strongly reduces E1A binding; when associated with A-134; A-141 and A-150.
- R141 (= R123) mutation to A: Strongly reduces E1A binding; when associated with A-134; A-138 and A-150.
- RR 141:142 (= RR 123:124) mutation to AA: Strongly reduces E1A binding; when associated with A-163 and A-171.
- L150 (≠ R131) mutation to A: Strongly reduces E1A binding; when associated with A-134; A-138 and A-141.
- R163 (≠ A141) mutation to A: Strongly reduces E1A binding; when associated with A-141; A-142 and A-171.
- R171 (= R149) mutation to A: Strongly reduces E1A binding; when associated with A-141; A-142 and A-163.
- G181 (= G159) mutation to V: Strongly reduces E1A binding; when associated with V-183 and A-204.
- G183 (= G161) mutation to A: Reduced proteolytic processing mediated by CAPN3; when associated with A-186.; mutation to V: Strongly reduces E1A binding; when associated with V-181 and A-204.
- G186 (= G164) mutation to A: Reduced proteolytic processing mediated by CAPN3; when associated with A-183.
- D204 (= D182) mutation to A: Strongly reduces E1A binding; when associated with V-181 and V-183.; mutation to L: Reduced proteolytic processing mediated by CAPN3.
- R266 (= R244) mutation to A: Strongly reduces E1A binding; when associated with A-290; A-295 and A-315.
- D290 (= D269) mutation to A: Strongly reduces E1A binding; when associated with A-266; A-295 and A-315.
- E295 (= E274) mutation to A: Strongly reduces E1A binding; when associated with A-266; A-290 and A-315.
- H315 (= H301) mutation to A: Strongly reduces E1A binding; when associated with A-266; A-290 and A-295.
Sites not aligning to the query:
- 375:376 Cleavage; by CAPN1
- 387:388 Cleavage; by CAPN1
- 409:410 Cleavage; by CAPN1 and CAPN3
- 422 modified: Phosphoserine; by HIPK2; S→A: Abolishes phosphorylation by HIPK2 and prevents UV-induced clearance.
- 428 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
8atiA Human ctbp2(31-364) in complex with rai2 peptide(315-322)
33% identity, 92% coverage: 23:332/336 of query aligns to 14:323/330 of 8atiA
- binding nicotinamide-adenine-dinucleotide: S74 (≠ V82), T102 (≠ V110), G155 (= G159), G157 (= G161), R158 (= R162), T159 (≠ I163), D178 (= D182), P179 (= P183), Y180 (≠ Q184), H210 (= H214), C211 (= C215), N212 (≠ P216), A238 (≠ T242), R240 (= R244), H289 (= H301), A291 (= A303), W292 (≠ F304)
- binding : M16 (≠ A25), V25 (= V34), A26 (≠ D35), F27 (= F36), C28 (≠ L37), E35 (≠ D44), H37 (≠ D46)
Sites not aligning to the query:
4lcjA Ctbp2 in complex with substrate mtob (see paper)
33% identity, 92% coverage: 23:332/336 of query aligns to 14:323/330 of 4lcjA
- active site: A98 (≠ G106), R240 (= R244), D264 (= D269), E269 (= E274), H289 (= H301)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: Y50 (≠ V58), H51 (≠ W59), I72 (≠ F80), G73 (= G81), S74 (≠ V82), G75 (= G83), R240 (= R244), H289 (= H301), W292 (≠ F304)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ V82), T102 (≠ V110), I154 (≠ V158), G155 (= G159), G157 (= G161), R158 (= R162), T159 (≠ I163), D178 (= D182), Y180 (≠ Q184), H210 (= H214), C211 (= C215), N212 (≠ P216), N214 (≠ T218), N217 (≠ T221), A238 (≠ T242), A239 (= A243), R240 (= R244), H289 (= H301), W292 (≠ F304)
P56545 C-terminal-binding protein 2; CtBP2 from Homo sapiens (Human)
33% identity, 92% coverage: 23:332/336 of query aligns to 46:355/445 of P56545
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
39% identity, 81% coverage: 54:325/336 of query aligns to 43:301/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
39% identity, 81% coverage: 54:325/336 of query aligns to 44:302/525 of 3ddnB
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
42% identity, 70% coverage: 75:309/336 of query aligns to 77:310/336 of 5z20F
- active site: S108 (≠ G106), R241 (= R244), D265 (= D269), E270 (= E274), H302 (= H301)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y105), G160 (= G161), Q161 (≠ R162), I162 (= I163), Y180 (= Y181), D181 (= D182), P182 (= P183), C212 (= C215), P213 (= P216), T218 (= T221), T239 (= T242), G240 (≠ A243), R241 (= R244), H302 (= H301), A304 (= A303)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
36% identity, 79% coverage: 48:313/336 of query aligns to 41:303/334 of 5aovA
- active site: L100 (≠ G106), R241 (= R244), D265 (= D269), E270 (= E274), H288 (= H301)
- binding glyoxylic acid: M52 (≠ V58), L53 (≠ W59), L53 (≠ W59), Y74 (≠ F80), A75 (≠ G81), V76 (= V82), G77 (= G83), R241 (= R244), H288 (= H301)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V82), T104 (≠ V110), F158 (≠ V160), G159 (= G161), R160 (= R162), I161 (= I163), S180 (≠ D182), R181 (≠ P183), A211 (≠ H214), V212 (≠ C215), P213 (= P216), T218 (= T221), I239 (≠ T242), A240 (= A243), R241 (= R244), H288 (= H301), G290 (vs. gap)
4zgsA Identification of the pyruvate reductase of chlamydomonas reinhardtii (see paper)
33% identity, 89% coverage: 36:334/336 of query aligns to 34:344/346 of 4zgsA
- active site: S111 (≠ G106), R244 (= R244), D268 (= D269), E273 (= E274), H311 (= H301)
- binding nicotinamide-adenine-dinucleotide: Y110 (= Y105), G163 (= G161), A164 (≠ R162), I165 (= I163), D184 (= D182), C215 (= C215), P216 (= P216), L218 (≠ T218), S220 (≠ E220), T221 (= T221), S243 (≠ A243), H311 (= H301), F314 (= F304)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
29% identity, 82% coverage: 51:326/336 of query aligns to 43:319/334 of 3kb6B
- active site: S97 (≠ G106), R231 (= R244), D255 (= D269), E260 (vs. gap), H294 (= H301)
- binding lactic acid: F49 (≠ L57), S72 (≠ G81), V73 (= V82), G74 (= G83), Y96 (= Y105), R231 (= R244), H294 (= H301)
- binding nicotinamide-adenine-dinucleotide: V73 (= V82), Y96 (= Y105), V101 (= V110), G150 (= G161), R151 (= R162), I152 (= I163), D171 (= D182), V172 (≠ P183), P203 (= P216), T229 (= T242), A230 (= A243), R231 (= R244), H294 (= H301), A296 (= A303), Y297 (≠ F304)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
39% identity, 62% coverage: 75:282/336 of query aligns to 76:283/328 of Q9UBQ7
Sites not aligning to the query:
- 293:296 binding
- 295 binding
Query Sequence
>AZOBR_RS16015 FitnessBrowser__azobra:AZOBR_RS16015
MTMGKRAPFVVGITDHMIPPPDLEAAVLDGCAEVDFLDTRREEDLDPERLARLDALLVWS
TRIGPATVAKLPRCRVVVRFGVGYDKVDVAALEAAGIPFCNNPDYGTEEVADHAVSLLLS
LQRRLWEHDARARGYSTTWQANTLTPLRRSSAATVGVVGVGRIGTAVVNRLKPFGYRILG
YDPQQPAGHEKAVGYRRVRRLDELLAESDIVTFHCPLTPETRGLIDADFLAKLKPGALLV
NTARGEMFAGLDPLEAALRSGHVAAVGTDVLPTEPPAPHPLLDAWRRRESWLDGRLVVTP
HNAFHSDEAAIEMRRNAAETARLFLEDRVLRNRILP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory