SitesBLAST
Comparing AZOBR_RS16915 FitnessBrowser__azobra:AZOBR_RS16915 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
64% identity, 99% coverage: 2:311/312 of query aligns to 3:314/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G201), R205 (= R202), G206 (= G203), S230 (= S227), R231 (= R228), A232 (= A229), Q244 (= Q241), V245 (= V242), G246 (= G243), Q247 (= Q244), T248 (= T245), G261 (= G258), I262 (= I259), S263 (= S260), A265 (= A262), Q267 (= Q264), H268 (= H265), N282 (= N279), K283 (= K280), D284 (= D281), A299 (= A296), D300 (= D297), L301 (= L298), F302 (= F299)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
64% identity, 99% coverage: 2:311/312 of query aligns to 21:332/333 of P13804
- G116 (= G95) to R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- T171 (= T150) to I: decreased protein stability; dbSNP:rs1801591
- R223 (= R202) binding
- S248 (= S227) binding
- R249 (= R228) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (= VGQT 242:245) binding
- T266 (= T245) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (= SGAIQH 260:265) binding
- N300 (= N279) binding
- DL 318:319 (= DL 297:298) binding
Sites not aligning to the query:
- 20:204 Domain I
- 205:333 Domain II
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
62% identity, 99% coverage: 2:309/312 of query aligns to 1:307/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G201), R200 (= R202), G201 (= G203), S225 (= S227), R226 (= R228), A227 (= A229), Q239 (= Q241), V240 (= V242), G241 (= G243), Q242 (= Q244), T243 (= T245), G256 (= G258), I257 (= I259), S258 (= S260), A260 (= A262), Q262 (= Q264), H263 (= H265), N277 (= N279), K278 (= K280), D279 (= D281), G294 (≠ A296), D295 (= D297), L296 (= L298), F297 (= F299)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
39% identity, 92% coverage: 25:311/312 of query aligns to 94:390/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (≠ A110), R200 (= R125), F203 (≠ Y128), I211 (≠ V136), G280 (= G201), M281 (≠ R202), G282 (= G203), S306 (= S227), R307 (= R228), A308 (= A229), Q320 (= Q241), V321 (= V242), G322 (= G243), Q323 (= Q244), T324 (= T245), G325 (= G246), G337 (= G258), I338 (= I259), S339 (= S260), A341 (= A262), Q343 (= Q264), H344 (= H265), N358 (= N279), K359 (= K280), N360 (≠ D281), G375 (≠ A296), D376 (= D297), L377 (= L298)
Sites not aligning to the query:
- binding iron/sulfur cluster: 7, 8, 10, 13, 17, 18, 35, 36, 37, 38, 41, 45, 49
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
37% identity, 99% coverage: 2:309/312 of query aligns to 3:324/331 of 5ol2A
- binding calcium ion: E75 (= E71), D188 (≠ G174)
- binding flavin-adenine dinucleotide: L116 (≠ A110), T117 (≠ I111), R136 (= R125), I147 (≠ V136), G216 (= G201), R217 (= R202), G218 (= G203), S242 (= S227), R243 (= R228), A244 (= A229), Q256 (= Q241), V257 (= V242), G258 (= G243), Q259 (= Q244), T260 (= T245), G273 (= G258), I274 (= I259), S275 (= S260), A277 (= A262), Q279 (= Q264), H280 (= H265), N294 (= N279), K295 (= K280), N296 (≠ D281), G311 (≠ A296), D312 (= D297), V313 (≠ L298), H314 (≠ F299)
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
40% identity, 71% coverage: 87:309/312 of query aligns to 102:332/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (≠ A110), C126 (≠ I111), R144 (= R125), A146 (≠ I127), A153 (= A134), I155 (≠ V136), G224 (= G201), R225 (= R202), G226 (= G203), S250 (= S227), R251 (= R228), A252 (= A229), Q264 (= Q241), V265 (= V242), G266 (= G243), Q267 (= Q244), S268 (≠ T245), G281 (= G258), I282 (= I259), S283 (= S260), S285 (≠ A262), Q287 (= Q264), H288 (= H265), I301 (= I278), N302 (= N279), K303 (= K280), D304 (= D281), G319 (≠ A296), D320 (= D297), A321 (≠ L298)
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
43% identity, 72% coverage: 84:309/312 of query aligns to 69:291/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G201), R184 (= R202), G185 (= G203), S209 (= S227), R210 (= R228), G211 (≠ A229), Q223 (= Q241), I224 (≠ V242), G225 (= G243), Q226 (= Q244), T227 (= T245), G240 (= G258), V241 (≠ I259), S242 (= S260), A244 (= A262), Q246 (= Q264), H247 (= H265), I260 (= I278), N261 (= N279), K262 (= K280), D263 (= D281), G278 (≠ A296), D279 (= D297), Y280 (≠ L298)
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
37% identity, 98% coverage: 3:309/312 of query aligns to 7:327/336 of 7koeB
- binding flavin-adenine dinucleotide: L120 (≠ A110), T121 (≠ I111), R140 (= R125), T142 (≠ I127), A149 (= A134), I151 (≠ V136), G219 (= G201), K220 (≠ R202), G221 (= G203), S245 (= S227), R246 (= R228), A247 (= A229), Q259 (= Q241), V260 (= V242), G261 (= G243), Q262 (= Q244), T263 (= T245), G264 (= G246), G276 (= G258), I277 (= I259), S278 (= S260), A280 (= A262), Q282 (= Q264), H283 (= H265), I296 (= I278), N297 (= N279), I298 (≠ K280), D299 (= D281), G314 (≠ A296), D315 (= D297), L316 (= L298)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 99% coverage: 3:310/312 of query aligns to 13:332/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (≠ A110), T126 (≠ I111), R144 (= R125), A153 (= A134), I155 (≠ V136), G223 (= G201), R224 (= R202), G225 (= G203), T249 (≠ S227), R250 (= R228), P251 (≠ A229), Q263 (= Q241), I264 (≠ V242), G265 (= G243), L266 (≠ Q244), S267 (≠ T245), G280 (= G258), I281 (= I259), S282 (= S260), A284 (= A262), Q286 (= Q264), F287 (≠ H265), I300 (= I278), N301 (= N279), S302 (≠ K280), D303 (= D281), G318 (≠ A296), D319 (= D297), L320 (= L298), Y321 (≠ F299)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
33% identity, 98% coverage: 3:309/312 of query aligns to 4:319/321 of P53571
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
33% identity, 98% coverage: 3:309/312 of query aligns to 3:318/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G201), R210 (= R202), G211 (= G203), S235 (= S227), A236 (≠ R228), P237 (≠ A229), Q249 (= Q241), V250 (= V242), G251 (= G243), Q252 (= Q244), S253 (≠ T245), G254 (= G246), G267 (= G258), I268 (= I259), S269 (= S260), S271 (≠ A262), Q273 (= Q264), H274 (= H265), N288 (= N279), T289 (≠ K280), D290 (= D281), A305 (= A296), D306 (= D297), I307 (≠ L298), F308 (= F299)
Query Sequence
>AZOBR_RS16915 FitnessBrowser__azobra:AZOBR_RS16915
MSILVIAEHDNAALKAATLNAVSAAAKIGGEIHVLVAGQGAQAVAEAAATVAGVAKVLLA
DDAAYAHPLPENVAPLVVNLAKGYGHVLAAASSEGKNLLPRVAALLDVAAISDITGVVSA
DTFERPIYAGNAIATVKSADPIKVVTVRTTAFEAAAATGGSATVESIAGTGDAGSARFVG
QELTKSERPELTQAKIVVSGGRGMQSGENFKLLEALADKLGAAVGASRAAVDAGFVPNDY
QVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKVIVAINKDEEAPIFQVADYGLVADLFK
AVPELTAALDKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory