SitesBLAST
Comparing AZOBR_RS17455 AZOBR_RS17455 acyl-CoA dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
33% identity, 86% coverage: 31:364/387 of query aligns to 30:360/378 of 5ol2F
- active site: L124 (≠ V124), T125 (= T125), G241 (≠ E245)
- binding calcium ion: E33 (= E34), R35 (≠ G36)
- binding coenzyme a persulfide: L238 (= L242), R242 (= R246)
- binding flavin-adenine dinucleotide: F122 (≠ M122), L124 (≠ V124), T125 (= T125), P127 (= P127), T131 (= T131), F155 (≠ W155), I156 (= I156), T157 (≠ S157), E198 (≠ Q202), R267 (= R271), F270 (= F274), L274 (≠ I278), F277 (≠ N281), Q335 (= Q339), L336 (≠ F340), G338 (= G342), G339 (= G343)
Sites not aligning to the query:
2jifA Structure of human short-branched chain acyl-coa dehydrogenase (acadsb)
30% identity, 95% coverage: 12:380/387 of query aligns to 13:377/381 of 2jifA
- active site: L125 (≠ V124), S126 (≠ T125), G242 (≠ E245), E363 (≠ P366), K375 (≠ E378)
- binding coenzyme a persulfide: S132 (≠ T131), S134 (≠ T133), Y178 (≠ V177), Y232 (≠ F235), I236 (≠ L239), L239 (= L242), N240 (= N243), R243 (= R246), Y362 (≠ A365), E363 (≠ P366), G364 (≠ V367), I368 (≠ L371)
- binding flavin-adenine dinucleotide: F123 (≠ M122), L125 (≠ V124), S126 (≠ T125), G131 (= G130), S132 (≠ T131), W156 (= W155), I157 (= I156), S158 (= S157), K201 (≠ M207), T209 (= T212), R268 (= R271), F271 (= F274), L275 (≠ I278), F278 (≠ N281), L281 (≠ V284), E336 (≠ Q339), W337 (≠ F340), G340 (= G343), N367 (= N370), I368 (≠ L371)
P45954 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial; SBCAD; 2-methyl branched chain acyl-CoA dehydrogenase; 2-MEBCAD; 2-methylbutyryl-coenzyme A dehydrogenase; 2-methylbutyryl-CoA dehydrogenase; EC 1.3.8.5 from Homo sapiens (Human) (see 6 papers)
30% identity, 95% coverage: 12:380/387 of query aligns to 64:428/432 of P45954
- V137 (≠ A85) mutation to L: Decreased acyl-CoA dehydrogenase activity.
- F138 (vs. gap) mutation to L: Increased acyl-CoA dehydrogenase activity. No effect on substrate specificity.
- 174:183 (vs. 122:131, 20% identical) binding in other chain
- S183 (≠ T131) binding
- WIS 207:209 (= WIS 155:157) binding in other chain
- S210 (≠ R158) mutation to N: Increased acyl-CoA dehydrogenase activity. Changed substrate specificity.
- Y229 (≠ V177) binding
- L255 (vs. gap) to F: in SBCADD; loss of protein expression; loss of 2-methylbutyryl-CoA dehydrogenase activity; dbSNP:rs137852649
- Y283 (≠ F235) binding
- NEGR 291:294 (≠ NAER 243:246) binding
- I316 (≠ T268) to V: in dbSNP:rs1131430
- R319 (= R271) binding
- Q330 (= Q282) binding
- EWMGG 387:391 (≠ QFHGG 339:343) binding
- A416 (≠ S368) mutation to T: Increased acyl-CoA dehydrogenase activity. No effect on substrate specificity.
- ASN 416:418 (≠ STN 368:370) binding in other chain
Sites not aligning to the query:
- 1:33 modified: transit peptide, Mitochondrion
- 13 R → K: in dbSNP:rs12263012
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
35% identity, 91% coverage: 12:364/387 of query aligns to 13:356/374 of 5lnxD
- active site: L122 (≠ V124), T123 (= T125), G239 (≠ E245)
- binding flavin-adenine dinucleotide: L122 (≠ V124), T123 (= T125), G128 (= G130), S129 (≠ T131), F153 (≠ W155), T155 (≠ S157), R265 (= R271), Q267 (≠ V273), F268 (= F274), I272 (= I278), N275 (= N281), I278 (≠ V284), Q331 (= Q339), I332 (≠ F340), G335 (= G343)
Sites not aligning to the query:
3pfdC Crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr (see paper)
33% identity, 91% coverage: 12:364/387 of query aligns to 4:351/369 of 3pfdC
- active site: L116 (≠ V124), S117 (≠ T125), T233 (≠ E245)
- binding dihydroflavine-adenine dinucleotide: Y114 (≠ M122), L116 (≠ V124), S117 (≠ T125), G122 (= G130), S123 (≠ T131), W147 (= W155), I148 (= I156), T149 (≠ S157), R259 (= R271), F262 (= F274), V266 (≠ I278), N269 (= N281), Q326 (= Q339), L327 (≠ F340), G330 (= G343), I348 (≠ L361)
Sites not aligning to the query:
7p9xA Structure of cyclohex-1-ene-1-carboxyl-coa dehydrogenase complexed with cyclohex-1-ene-1-carboxyl-coa (see paper)
34% identity, 96% coverage: 14:384/387 of query aligns to 11:378/378 of 7p9xA
- binding 1-monoenoyl-CoA: L82 (≠ A85), D89 (≠ Y91), S129 (≠ T131), L131 (≠ T133), K176 (≠ E182), F229 (= F235), M233 (≠ L239), L236 (= L242), R240 (= R246), Y360 (≠ A365), T361 (≠ V367), G362 (≠ S368), R373 (≠ H379)
- binding flavin-adenine dinucleotide: A122 (≠ V124), T123 (= T125), G128 (= G130), S129 (≠ T131), F153 (≠ W155), I154 (= I156), T155 (≠ S157), N206 (= N209), L356 (= L361), Y360 (≠ A365), T363 (= T369), Q365 (≠ L371), I366 (= I372)
7p9aA Structure of cyclohex-1-ene-1-carboxyl-coa dehydrogenase complexed with cyclohex-1,5-diene-1-carboxyl-coa (see paper)
34% identity, 96% coverage: 14:384/387 of query aligns to 13:380/380 of 7p9aA
- binding 1,5 Dienoyl-CoA: S131 (≠ T131), L133 (≠ T133), K178 (≠ E182), F231 (= F235), M235 (≠ L239), L238 (= L242), N241 (≠ E245), R242 (= R246), Y362 (≠ A365), T363 (≠ V367), G364 (≠ S368), R375 (≠ H379)
- binding flavin-adenine dinucleotide: L122 (≠ M122), A124 (≠ V124), T125 (= T125), G130 (= G130), S131 (≠ T131), F155 (≠ W155), I156 (= I156), T157 (≠ S157), K200 (≠ V201), N208 (= N209), L358 (= L361), T365 (= T369), Q367 (≠ L371), I368 (= I372)
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
32% identity, 90% coverage: 32:381/387 of query aligns to 32:377/379 of 1ukwB
- active site: L124 (≠ V124), S125 (≠ T125), T241 (≠ E245), E362 (≠ P366), R374 (≠ E378)
- binding cobalt (ii) ion: D145 (= D145), H146 (≠ R146)
- binding flavin-adenine dinucleotide: F122 (≠ M122), L124 (≠ V124), S125 (≠ T125), G130 (= G130), S131 (≠ T131), W155 (= W155), S157 (= S157), K200 (≠ I204), L357 (= L361), Y361 (≠ A365), E362 (≠ P366), T364 (≠ S368), E366 (≠ N370), L370 (≠ A374)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
32% identity, 90% coverage: 32:381/387 of query aligns to 32:377/379 of 1ukwA
- active site: L124 (≠ V124), S125 (≠ T125), T241 (≠ E245), E362 (≠ P366), R374 (≠ E378)
- binding flavin-adenine dinucleotide: F122 (≠ M122), L124 (≠ V124), S125 (≠ T125), G130 (= G130), S131 (≠ T131), W155 (= W155), S157 (= S157), L357 (= L361), Y361 (≠ A365), E362 (≠ P366), T364 (≠ S368), E366 (≠ N370), L370 (≠ A374)
4iv6B X-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis (see paper)
34% identity, 87% coverage: 29:364/387 of query aligns to 26:359/383 of 4iv6B
- active site: L121 (≠ V124), T122 (= T125), G240 (≠ E245)
- binding dihydroflavine-adenine dinucleotide: L121 (≠ V124), T122 (= T125), G126 (≠ T129), G127 (= G130), S128 (≠ T131), W152 (= W155), I153 (= I156), S154 (= S157), R266 (= R271), S268 (≠ V273), F269 (= F274), I273 (= I278), H276 (≠ N281), V279 (= V284), R334 (≠ Q339), V335 (≠ F340), G338 (= G343), L356 (= L361)
Sites not aligning to the query:
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
30% identity, 96% coverage: 11:381/387 of query aligns to 7:377/380 of 4l1fA
- active site: L125 (≠ V124), T126 (= T125), G242 (≠ E245), E363 (≠ P366), R375 (≠ H379)
- binding coenzyme a persulfide: T132 (= T131), H179 (≠ R178), F232 (= F235), M236 (≠ L239), E237 (≠ T240), L239 (= L242), D240 (≠ N243), R243 (= R246), Y362 (≠ A365), E363 (≠ P366), G364 (≠ S368), R375 (≠ H379)
- binding flavin-adenine dinucleotide: F123 (≠ M122), L125 (≠ V124), T126 (= T125), G131 (= G130), T132 (= T131), F156 (≠ W155), I157 (= I156), T158 (≠ S157), R268 (= R271), Q270 (≠ V273), F271 (= F274), I275 (= I278), F278 (≠ N281), L281 (≠ V284), Q336 (= Q339), I337 (≠ F340), G340 (= G343), I358 (≠ L361), Y362 (≠ A365), T365 (= T369), Q367 (≠ L371)
- binding 1,3-propandiol: Q10 (≠ D14)
Sites not aligning to the query:
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
31% identity, 91% coverage: 12:364/387 of query aligns to 13:362/378 of 4n5fA
Sites not aligning to the query:
3mpjB Structure of the glutaryl-coenzyme a dehydrogenase (see paper)
32% identity, 97% coverage: 11:386/387 of query aligns to 15:387/393 of 3mpjB
- active site: I128 (≠ V124), T129 (= T125), T245 (≠ E245), E367 (≠ P366), L379 (≠ E378)
- binding flavin-adenine dinucleotide: F126 (≠ M122), I128 (≠ V124), T129 (= T125), G134 (= G130), S135 (≠ T131), W159 (= W155), I160 (= I156), S161 (= S157), V366 (≠ A365), S369 (= S368), N371 (= N370), M375 (≠ A374)
- binding : H36 (≠ G36), F37 (≠ Y37), Y39 (vs. gap), A164 (≠ Q160), Q165 (≠ H161), D167 (= D163), N193 (≠ E193)
C3UVB0 Glutaryl-CoA dehydrogenase; GDH(Des); EC 1.3.99.32 from Desulfococcus multivorans (see paper)
32% identity, 97% coverage: 11:386/387 of query aligns to 15:387/389 of C3UVB0
- A80 (≠ N77) mutation to E: Loses the FAD cofactor and dehydrogenase activity.
- R87 (≠ H87) binding
- V88 (≠ G88) mutation to S: A residual dehydrogenase activity is observed.
- N91 (= N92) binding
- FGIT 126:129 (≠ MGVT 122:125) binding
- S135 (≠ T131) binding ; binding
- WIS 159:161 (= WIS 155:157) binding
- S181 (= S181) binding
- R271 (= R271) binding
- FQMN 281:284 (≠ NQGV 281:284) binding
- R340 (≠ Q339) binding
- A344 (≠ G343) binding
- V366 (≠ A365) mutation to Y: Loses the FAD cofactor but a residual dehydrogenase activity is observed.
- EGSAN 367:371 (≠ PVSTN 366:370) binding
- R385 (≠ P384) binding
3mpiC Structure of the glutaryl-coenzyme a dehydrogenase glutaryl-coa complex (see paper)
32% identity, 97% coverage: 11:386/387 of query aligns to 15:387/395 of 3mpiC
- active site: I128 (≠ V124), T129 (= T125), T245 (≠ E245), E367 (≠ P366), L379 (≠ E378)
- binding flavin-adenine dinucleotide: I128 (≠ V124), T129 (= T125), G134 (= G130), S135 (≠ T131), W159 (= W155), I160 (= I156), S161 (= S157), M365 (≠ V364), V366 (≠ A365), S369 (= S368), N371 (= N370), M375 (≠ A374)
- binding glutaryl-coenzyme A: R87 (≠ H87), F126 (≠ M122), S135 (≠ T131), V137 (≠ T133), S181 (= S181), F239 (≠ L239), R246 (= R246), N315 (≠ P314), V366 (≠ A365), E367 (≠ P366), G368 (≠ V367), I376 (≠ Y375), R385 (≠ P384)
Sites not aligning to the query:
2d29A Structural study on project id tt0172 from thermus thermophilus hb8
34% identity, 91% coverage: 32:382/387 of query aligns to 33:384/386 of 2d29A
- active site: L126 (≠ V124), T127 (= T125), G247 (≠ E245), E368 (≠ P366), R380 (≠ E378)
- binding flavin-adenine dinucleotide: L126 (≠ V124), T127 (= T125), G132 (= G130), S133 (≠ T131), F157 (≠ W155), I158 (= I156), T159 (≠ S157), L363 (= L361), T370 (≠ S368), E372 (≠ N370)
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
30% identity, 92% coverage: 9:364/387 of query aligns to 3:360/379 of 6fahD
- active site: L124 (≠ V124), T125 (= T125), G241 (≠ E245)
- binding flavin-adenine dinucleotide: F122 (≠ M122), L124 (≠ V124), T125 (= T125), R152 (≠ Q152), F155 (≠ W155), T157 (≠ S157), E198 (≠ V201), R267 (= R271), Q269 (≠ V273), F270 (= F274), I274 (= I278), F277 (≠ N281), Q335 (= Q339), I336 (≠ F340), G339 (= G343)
Sites not aligning to the query:
7w0jE Acyl-coa dehydrogenase, tfu_1647
31% identity, 91% coverage: 12:364/387 of query aligns to 14:364/382 of 7w0jE
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: S127 (≠ T125), W157 (= W155), R270 (= R271), Q272 (≠ V273), F273 (= F274), I277 (= I278), F280 (≠ N281), I283 (≠ V284), Q339 (= Q339), L340 (≠ F340), G343 (= G343)
Sites not aligning to the query:
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: 365, 366, 368, 370, 371
8i4rA Crystal structure of acyl-coa dehydrogenase complexed with acetyl-coa from thermobifida fusca
31% identity, 91% coverage: 12:364/387 of query aligns to 13:363/381 of 8i4rA
- binding acetyl coenzyme *a: S132 (≠ T131), T134 (= T133), R180 (≠ K180), R234 (≠ K236), L237 (= L239), R238 (≠ T240), L240 (= L242), D241 (≠ N243), R244 (= R246)
- binding flavin-adenine dinucleotide: Y123 (≠ M122), L125 (≠ V124), S126 (≠ T125), G131 (= G130), S132 (≠ T131), W156 (= W155), I157 (= I156), T158 (≠ S157), I360 (≠ L361)
Sites not aligning to the query:
8i4pA Crystal structure of acyl-coa dehydrogenase from thermobifida fusca
31% identity, 91% coverage: 12:364/387 of query aligns to 13:363/381 of 8i4pA
Sites not aligning to the query:
Query Sequence
>AZOBR_RS17455 AZOBR_RS17455 acyl-CoA dehydrogenase
MKTSIGQGFDEIRDAVRALCAEFPSEYHRRIDEERGYPEAFVDALTKAGWMAALIPEEYG
GSGLGLTEASVIMEEINRSGGNSGACHGQMYNMNTLVRHGSEEQRRRYLPKIAAGELRLQ
SMGVTEPTTGTDTTRIKTRAEKKGDRYVINGQKVWISRVQHSDLMILLARTTPLDQVRKK
SEGMSIFIVDIKEAMQKGMTVQPIRNMVNHETNELFFDNLEIPAENLIGEEGQGFKYILT
GLNAERVLIAAECIGDGYWFIDKVCDYTRDRQVFGRPIAQNQGVQFPIAESFIEVEAANL
MRFEACRLYDAGEPCGAQANMAKYLAAKASWEAANACLQFHGGFGFASEYDVERKFRETR
LYQVAPVSTNLILAYVAEHVLDLPKSY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory