Comparing AZOBR_RS17960 FitnessBrowser__azobra:AZOBR_RS17960 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
58% identity, 98% coverage: 4:262/263 of query aligns to 6:264/265 of P07821
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 88% coverage: 2:233/263 of query aligns to 10:235/378 of P69874
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 86% coverage: 18:243/263 of query aligns to 11:233/240 of 6mjpA
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
32% identity, 85% coverage: 11:233/263 of query aligns to 5:227/262 of 7chaI
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
31% identity, 85% coverage: 21:243/263 of query aligns to 14:233/233 of 6b8bA
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
31% identity, 85% coverage: 21:243/263 of query aligns to 14:233/235 of 6mhzA
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
31% identity, 85% coverage: 21:243/263 of query aligns to 14:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
31% identity, 85% coverage: 21:243/263 of query aligns to 14:233/238 of 6s8gA
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
31% identity, 85% coverage: 21:243/263 of query aligns to 14:233/234 of 6b89A
Sites not aligning to the query:
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
31% identity, 85% coverage: 21:243/263 of query aligns to 14:233/234 of 4p31A
Sites not aligning to the query:
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 85% coverage: 21:243/263 of query aligns to 15:234/241 of 6mbnA
Sites not aligning to the query:
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
30% identity, 84% coverage: 7:227/263 of query aligns to 2:222/501 of P04983
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
32% identity, 84% coverage: 15:234/263 of query aligns to 10:228/278 of 8bmsA
5l22B Prtd t1ss abc transporter (see paper)
34% identity, 80% coverage: 24:234/263 of query aligns to 329:536/540 of 5l22B
Sites not aligning to the query:
5d3mA Folate ecf transporter: amppnp bound state (see paper)
32% identity, 86% coverage: 10:234/263 of query aligns to 8:231/280 of 5d3mA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 80% coverage: 25:235/263 of query aligns to 21:230/343 of P30750
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 80% coverage: 24:234/263 of query aligns to 16:224/240 of 4ymuJ
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 80% coverage: 25:235/263 of query aligns to 22:231/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 83% coverage: 17:235/263 of query aligns to 12:231/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 83% coverage: 17:235/263 of query aligns to 12:231/344 of 3tuiC
>AZOBR_RS17960 FitnessBrowser__azobra:AZOBR_RS17960
MSPDQTQPLYDLAGVSFSVAGRAILSGLSLRLEQGRIYGLVGPNGSGKSTLIRLLARQQP
PGGGTIRCLGTDLARIGDRDFARTVAYMPQFTPPAEGMTVRELVALGRFPWHGALGRFGA
EDAAKVAEAIAETHLDAFADRLVDSLSGGERQRVWLAMMLAQDTRCLLLDEPTSALDIAS
QVELLGLVRRLSRARGIGAVIVLHDINMAASVCDEILAMRNGALIAQGTPDAIMTGETLG
AIYHLAMTTVPHPVTGKPIGCVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory