Comparing AZOBR_RS18020 FitnessBrowser__azobra:AZOBR_RS18020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8K4H1 Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 from Mus musculus (Mouse) (see paper)
31% identity, 95% coverage: 13:283/284 of query aligns to 35:304/305 of Q8K4H1
7bfrA Thermogutta terrifontis esterase 2 phosphorylated by paraoxon (see paper)
26% identity, 67% coverage: 69:258/284 of query aligns to 44:227/260 of 7bfrA
5aobA The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-butyrate bound (see paper)
24% identity, 67% coverage: 69:258/284 of query aligns to 44:244/278 of 5aobA
5aocA The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-valerate bound (see paper)
24% identity, 67% coverage: 69:258/284 of query aligns to 48:243/277 of 5aocA
P79066 Lipase 1; Lipase I; TFL I; EC 3.1.1.3 from Dipodascus fermentans (Yeast) (Trichosporon fermentans) (see paper)
31% identity, 54% coverage: 26:179/284 of query aligns to 93:269/563 of P79066
Sites not aligning to the query:
P22394 Lipase 2; GCL II; Lipase II; EC 3.1.1.3 from Geotrichum candidum (Oospora lactis) (Dipodascus geotrichum) (see paper)
31% identity, 54% coverage: 26:179/284 of query aligns to 93:269/563 of P22394
Sites not aligning to the query:
2fj0A Crystal structure of juvenile hormone esterase from manduca sexta, with otfp covalently attached (see paper)
30% identity, 46% coverage: 64:193/284 of query aligns to 101:237/530 of 2fj0A
Sites not aligning to the query:
P17573 Lipase 1; GCL I; Lipase I; EC 3.1.1.3 from Geotrichum candidum (Oospora lactis) (Dipodascus geotrichum) (see paper)
31% identity, 48% coverage: 43:179/284 of query aligns to 111:269/563 of P17573
Sites not aligning to the query:
1qe3A Pnb esterase (see paper)
32% identity, 41% coverage: 55:170/284 of query aligns to 75:207/467 of 1qe3A
Sites not aligning to the query:
P37967 Para-nitrobenzyl esterase; Intracellular esterase B; PNB carboxy-esterase; PNBCE; EC 3.1.1.- from Bacillus subtilis (strain 168) (see paper)
31% identity, 41% coverage: 55:170/284 of query aligns to 85:217/489 of P37967
1c7iA Thermophylic pnb esterase (see paper)
32% identity, 41% coverage: 55:170/284 of query aligns to 84:216/483 of 1c7iA
Sites not aligning to the query:
7w1iA Crystal structure of carboxylesterase mutant from thermobifida fusca with c8x and c9c
33% identity, 39% coverage: 64:175/284 of query aligns to 97:218/497 of 7w1iA
Sites not aligning to the query:
7w1jA Crystal structure of carboxylesterase from thermobifida fusca with j1k
33% identity, 39% coverage: 64:175/284 of query aligns to 96:217/494 of 7w1jA
Sites not aligning to the query:
P07882 Bile salt-activated lipase; BAL; Bile salt-stimulated lipase; BSSL; Carboxyl ester lipase; Cholesterol esterase; Pancreatic lysophospholipase; Sterol esterase; EC 3.1.1.13; EC 3.1.1.3; EC 3.1.1.6 from Rattus norvegicus (Rat) (see 2 papers)
32% identity, 31% coverage: 66:153/284 of query aligns to 119:222/612 of P07882
Sites not aligning to the query:
1qz3A Crystal structure of mutant m211s/r215l of carboxylesterase est2 complexed with hexadecanesulfonate (see paper)
34% identity, 36% coverage: 63:163/284 of query aligns to 71:174/309 of 1qz3A
Sites not aligning to the query:
6ieyA Crystal structure of chloramphenicol-metabolizaing enzyme estdl136- chloramphenicol complex (see paper)
36% identity, 30% coverage: 67:152/284 of query aligns to 67:153/307 of 6ieyA
Sites not aligning to the query:
4ob6A Complex structure of esterase rppe s159a/w187h and substrate (s)-ac- cpa (see paper)
28% identity, 39% coverage: 57:167/284 of query aligns to 70:184/319 of 4ob6A
Sites not aligning to the query:
B0F2B4 Neuroligin 4-like; Neuroligin-4; NL-4 from Mus musculus (Mouse) (see paper)
30% identity, 40% coverage: 66:179/284 of query aligns to 176:290/945 of B0F2B4
Sites not aligning to the query:
Q20826 Neuroligin-like protein glit-1; Gliotactin homolog; Inactive esterase glit-1 from Caenorhabditis elegans (see paper)
30% identity, 35% coverage: 56:155/284 of query aligns to 181:286/730 of Q20826
Sites not aligning to the query:
6h18A Crystal structure of sarin surrogate nimp inhibited recombinant human bile salt activated lipase (see paper)
27% identity, 39% coverage: 44:153/284 of query aligns to 73:203/523 of 6h18A
Sites not aligning to the query:
>AZOBR_RS18020 FitnessBrowser__azobra:AZOBR_RS18020
VSVVPDDHEWQYNPRHSVPDFARHAERAAALSRAARERNAGRYDIAYGDTPLSTLDVFPA
AAPGAPLHVFLHGGYWRGRDKADYSYVADALVPRGVTTVVMNYDLCPAATLPEIARRTRE
GLRWIHRNAASLGGDPDRLTVSGHSAGAHLIAMALAEDAGAGADRLEDGAIKAAVLISGI
YELAPVLDITVNETIGLRPEMVDGVSPMRHPPSTATALTVVVGSAETPAWIAQSRDFATL
CQCRGSRCTYHTLAGEDHFSIMARMERPDDTLSRLVLDAAGVKE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory