Comparing AZOBR_RS18060 FitnessBrowser__azobra:AZOBR_RS18060 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
55% identity, 98% coverage: 1:238/244 of query aligns to 1:238/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
55% identity, 98% coverage: 1:238/244 of query aligns to 1:238/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
55% identity, 98% coverage: 1:238/244 of query aligns to 1:238/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
55% identity, 98% coverage: 1:238/244 of query aligns to 1:238/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
55% identity, 98% coverage: 3:242/244 of query aligns to 1:240/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
55% identity, 97% coverage: 3:238/244 of query aligns to 2:236/241 of 4u00A
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
47% identity, 98% coverage: 4:242/244 of query aligns to 3:253/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
47% identity, 98% coverage: 4:242/244 of query aligns to 7:257/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 98% coverage: 3:242/244 of query aligns to 1:245/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
40% identity, 98% coverage: 3:242/244 of query aligns to 2:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
40% identity, 98% coverage: 3:242/244 of query aligns to 2:246/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
40% identity, 98% coverage: 3:242/244 of query aligns to 2:246/344 of 6cvlD
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 97% coverage: 3:239/244 of query aligns to 17:249/378 of P69874
Sites not aligning to the query:
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
40% identity, 89% coverage: 1:216/244 of query aligns to 1:220/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
38% identity, 96% coverage: 1:234/244 of query aligns to 1:238/592 of 5lj7A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
40% identity, 85% coverage: 9:216/244 of query aligns to 9:216/223 of 2pclA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
33% identity, 98% coverage: 1:240/244 of query aligns to 4:245/375 of 2d62A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 98% coverage: 1:240/244 of query aligns to 1:236/369 of P19566
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 95% coverage: 7:238/244 of query aligns to 30:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
37% identity, 95% coverage: 7:238/244 of query aligns to 30:263/382 of 7aheC
Sites not aligning to the query:
>AZOBR_RS18060 FitnessBrowser__azobra:AZOBR_RS18060
MSLIAITEVKKRFGDVEVLKGINLDVERGEVVAIIGKSGSGKSTLLRCVNGLEMIDDGSI
MVAGAQLINDDLHLKALRLKVGMIFQQFNLFPHLSAGRNVMLSQMVVKKTPAREAEAMAR
RMLERVGLGHKFDAYPDQLSGGQQQRVAIARALSMQPMALLCDEITSALDPELVNEVLAV
VKELAADGMTLMMVTHEMRFAREVCDRVVFMHQGRVHEIGPPEEVFGNPRTPELRQFLGA
QLVV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory