Comparing AZOBR_RS18075 FitnessBrowser__azobra:AZOBR_RS18075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
36% identity, 84% coverage: 36:255/263 of query aligns to 3:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
36% identity, 84% coverage: 36:255/263 of query aligns to 3:223/225 of 4zv2A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
32% identity, 87% coverage: 29:256/263 of query aligns to 2:228/229 of 6svfA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
31% identity, 86% coverage: 29:255/263 of query aligns to 2:228/229 of 5t0wA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
30% identity, 85% coverage: 33:255/263 of query aligns to 7:231/247 of 2yjpA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
30% identity, 88% coverage: 25:255/263 of query aligns to 1:234/243 of 5eyfB
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
30% identity, 71% coverage: 28:213/263 of query aligns to 5:192/251 of 1xt8B
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
25% identity, 88% coverage: 29:259/263 of query aligns to 5:234/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
25% identity, 88% coverage: 29:259/263 of query aligns to 9:238/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
25% identity, 88% coverage: 29:259/263 of query aligns to 9:238/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
25% identity, 88% coverage: 29:259/263 of query aligns to 9:238/241 of 3vvdA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
29% identity, 87% coverage: 33:261/263 of query aligns to 4:237/237 of 4i62A
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
27% identity, 89% coverage: 22:256/263 of query aligns to 35:272/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
27% identity, 89% coverage: 22:256/263 of query aligns to 35:272/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
27% identity, 89% coverage: 22:256/263 of query aligns to 36:273/288 of 6h2tA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
27% identity, 83% coverage: 37:255/263 of query aligns to 1:222/224 of 4ymxA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
28% identity, 84% coverage: 38:259/263 of query aligns to 27:257/260 of P0AEU0
Sites not aligning to the query:
7a99B Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp (see paper)
40% identity, 35% coverage: 29:120/263 of query aligns to 1:92/130 of 7a99B
Sites not aligning to the query:
5lomB Crystal structure of the pbp soca from agrobacterium tumefaciens c58 in complex with dfg at 1.5 a resolution (see paper)
27% identity, 85% coverage: 38:261/263 of query aligns to 13:243/250 of 5lomB
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
27% identity, 84% coverage: 39:259/263 of query aligns to 28:257/260 of P02910
Sites not aligning to the query:
>AZOBR_RS18075 FitnessBrowser__azobra:AZOBR_RS18075
MKRRTLLALAVAAVAGLSIAQAPAARADALQDITKRGTLRVAVPQDFPPFGSVGPDMAPL
GYDIDVAKLIGAKMGVKVELVPVTSANRIPFLQTNKVDLVISSLGKNAEREKVIDFTDAY
APFFNGVFAPAGVTAAKPEDLAGKTVGVTRGAIEDLELTKIAPADAVIKRYEDNNGTISA
FLSGQVEVVATGNVVAAAILARNPPKRPELKFLIKNSPCYIGLSKEQPALLEKLNGILAA
AKADGSLNAIAQKWLSADLPKDL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory