Comparing AZOBR_RS18320 FitnessBrowser__azobra:AZOBR_RS18320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
35% identity, 85% coverage: 26:291/314 of query aligns to 20:288/304 of 1wwkA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
33% identity, 91% coverage: 2:288/314 of query aligns to 3:285/303 of 6plgA
7dkmA Phgdh covalently linked to oridonin (see paper)
33% identity, 91% coverage: 2:288/314 of query aligns to 4:286/306 of 7dkmA
Sites not aligning to the query:
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
33% identity, 91% coverage: 2:288/314 of query aligns to 3:285/302 of 7ewhA
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
33% identity, 91% coverage: 2:288/314 of query aligns to 3:285/302 of 6rihA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
33% identity, 91% coverage: 2:288/314 of query aligns to 3:285/301 of 6rj5A
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 91% coverage: 2:288/314 of query aligns to 4:286/305 of 6plfA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
33% identity, 91% coverage: 2:288/314 of query aligns to 2:284/297 of 6rj3A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
33% identity, 91% coverage: 2:288/314 of query aligns to 2:284/299 of 6cwaA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
33% identity, 91% coverage: 2:288/314 of query aligns to 8:290/533 of O43175
Sites not aligning to the query:
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
34% identity, 85% coverage: 22:288/314 of query aligns to 15:282/299 of 6rj2A
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
36% identity, 73% coverage: 61:288/314 of query aligns to 47:276/292 of 6plfB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
34% identity, 84% coverage: 46:310/314 of query aligns to 40:306/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
34% identity, 84% coverage: 46:310/314 of query aligns to 41:307/525 of 3ddnB
7cvpA The crystal structure of human phgdh from biortus.
37% identity, 61% coverage: 97:288/314 of query aligns to 41:239/254 of 7cvpA
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
38% identity, 58% coverage: 106:288/314 of query aligns to 8:191/195 of 5ofwA
Sites not aligning to the query:
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
38% identity, 58% coverage: 106:288/314 of query aligns to 8:191/195 of 5ofvA
Sites not aligning to the query:
5ofmA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-amino-1-methyl-1h-indole
38% identity, 58% coverage: 106:288/314 of query aligns to 8:191/195 of 5ofmA
Sites not aligning to the query:
5nzqA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-(1,3-oxazol-5-yl)aniline. (see paper)
38% identity, 58% coverage: 106:288/314 of query aligns to 8:191/195 of 5nzqA
Sites not aligning to the query:
5nzpA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-hydroxybenzisoxazole (see paper)
38% identity, 58% coverage: 106:288/314 of query aligns to 8:191/195 of 5nzpA
Sites not aligning to the query:
>AZOBR_RS18320 FitnessBrowser__azobra:AZOBR_RS18320
MKIAILDDYQNVARDLAEWHRLPNGSALTVFERPIPAEEVVGTLAPYSVLVIMRERTPFP
ASLIDALPNLRLLVTTGGRNNAIDLEACKARGITVCGTGMVGTPTAELTWGLILALTKRI
PQEERGLRAGRWQAGLTQGLAGKRLGLVGLGKLGTQVARVGQAFGMEVAAWSPNLTDERA
AAAGVARLDKRDLFATSDIVSVHLVLGERTRGVVGADDIDAMKPSAFFVNTSRAGLVDGD
ALLAALHEHRIAGAGLDVFPVEPLPVDSPWLEAPNTVLTPHLGYVTRENYEVFYRDALDD
ILAWHAGEPVRMLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory