SitesBLAST
Comparing AZOBR_RS18565 FitnessBrowser__azobra:AZOBR_RS18565 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3kljA Crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum (see paper)
31% identity, 45% coverage: 13:382/821 of query aligns to 4:352/378 of 3kljA
- active site: P12 (≠ M21), R41 (= R53), P42 (≠ I54), N274 (≠ F301)
- binding flavin-adenine dinucleotide: L8 (≠ V17), G9 (= G18), G11 (= G20), P12 (≠ M21), A13 (= A22), N32 (≠ G44), S33 (≠ A45), E34 (= E46), R41 (= R53), P42 (≠ I54), F77 (≠ R89), A78 (≠ V90), S105 (≠ T117), G106 (= G118), L123 (≠ F137), Y124 (≠ R138), L150 (= L164), G257 (= G284), D258 (≠ E285), G268 (= G295), L269 (= L296), I270 (≠ V297), A273 (≠ L300), K301 (= K329)
Q9AL95 NADH-rubredoxin oxidoreductase; NROR; NADH:rubredoxin oxidoreductase; EC 1.18.1.1 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
31% identity, 45% coverage: 13:382/821 of query aligns to 5:353/379 of Q9AL95
- C26 (≠ A34) modified: Disulfide link with 286
- NSE 33:35 (≠ GAE 44:46) binding
- R42 (= R53) binding
- A79 (≠ V90) binding
- Y125 (≠ R138) binding
- C137 (≠ A150) modified: Disulfide link with 216
- C216 (≠ L242) modified: Disulfide link with 137
- D259 (≠ E285) binding
- C286 (≠ A312) modified: Disulfide link with 26
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
33% identity, 35% coverage: 1:286/821 of query aligns to 1:276/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G20), V12 (≠ M21), G13 (≠ A22), D35 (≠ A45), E36 (= E46), R43 (= R53), P44 (≠ I54), S47 (= S57), K48 (≠ P58), V80 (= V90), T107 (= T117), G108 (= G118), R128 (= R138), G274 (= G284), D275 (≠ E285)
Sites not aligning to the query:
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
33% identity, 33% coverage: 14:286/821 of query aligns to 4:275/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G20), V11 (≠ M21), G12 (≠ A22), D34 (≠ A45), E35 (= E46), R42 (= R53), P43 (≠ I54), K47 (≠ P58), E78 (≠ R89), V79 (= V90), T106 (= T117), G107 (= G118), G273 (= G284), D274 (≠ E285)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ V122), G149 (= G160), L152 (= L163), I153 (≠ L164), E156 (= E167), E172 (≠ H183), A173 (≠ L184), R180 (= R191), V236 (= V247), G237 (= G248), A238 (≠ I249)
Sites not aligning to the query:
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
34% identity, 34% coverage: 12:294/821 of query aligns to 5:293/422 of P16640
- A15 (= A22) binding
- D37 (≠ G44) binding
- K50 (≠ S57) binding
- V83 (= V90) binding
- R134 (vs. gap) binding
- D284 (≠ E285) binding
Sites not aligning to the query:
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
34% identity, 34% coverage: 12:294/821 of query aligns to 4:292/422 of 1q1wA
- active site: L13 (≠ M21), L44 (≠ N52), P45 (≠ R53)
- binding flavin-adenine dinucleotide: G10 (= G18), G12 (= G20), L13 (≠ M21), A14 (= A22), G35 (≠ F43), D36 (≠ G44), L44 (≠ N52), P45 (≠ R53), K49 (≠ S57), V82 (= V90), A108 (= A116), T109 (= T117), G110 (= G118), R133 (vs. gap), I159 (≠ L164), D283 (≠ E285)
Sites not aligning to the query:
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
36% identity, 32% coverage: 80:339/821 of query aligns to 76:346/541 of 6pfzA
- binding calcium ion: D306 (≠ E302), T332 (≠ S325)
- binding coenzyme a: K76 (≠ N80), R313 (≠ K305)
- binding flavin-adenine dinucleotide: A86 (≠ V90), A115 (= A116), T116 (= T117), G117 (= G118), L136 (≠ F137), G286 (= G284), D287 (≠ E285), P303 (= P299), F304 (≠ L300), G305 (≠ F301)
Sites not aligning to the query:
- active site: 37, 42, 455, 456
- binding calcium ion: 427, 428
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 430, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
30% identity, 45% coverage: 13:380/821 of query aligns to 2:345/359 of Q8U1K9
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
33% identity, 37% coverage: 39:341/821 of query aligns to 29:334/443 of 6rvhA
- active site: V39 (≠ P49), C44 (≠ I54), E53 (= E63), E58 (= E67), Y159 (≠ L163), E163 (= E167)
- binding coenzyme a: S40 (≠ N50), Y41 (= Y51), C44 (≠ I54), R63 (≠ N72), N303 (≠ K305), R307 (= R310)
- binding flavin-adenine dinucleotide: E34 (≠ G44), K35 (≠ A45), A43 (≠ R53), C44 (≠ I54), V81 (= V90), T113 (= T117), G114 (= G118), R134 (= R138), Y159 (≠ L163), G280 (= G284), D281 (≠ E285), P297 (= P299), L298 (= L300), G299 (≠ F301)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 20, 23, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
33% identity, 37% coverage: 39:341/821 of query aligns to 29:334/443 of 6rvbA
- active site: V39 (≠ P49), C44 (≠ I54), E53 (= E63), E58 (= E67), Y159 (≠ L163), E163 (= E167)
- binding coenzyme a: S40 (≠ N50), Y41 (= Y51), C44 (≠ I54), R63 (≠ N72), N303 (≠ K305), R307 (= R310)
- binding flavin-adenine dinucleotide: Y33 (≠ F43), E34 (≠ G44), K35 (≠ A45), S36 (≠ E46), A43 (≠ R53), C44 (≠ I54), E80 (≠ R89), V81 (= V90), T113 (= T117), G114 (= G118), L133 (≠ F137), R134 (= R138), I160 (≠ L164), G280 (= G284), D281 (≠ E285), L298 (= L300), G299 (≠ F301)
- binding nicotinamide-adenine-dinucleotide: G156 (= G160), G158 (= G162), Y159 (≠ L163), I160 (≠ L164), E179 (≠ H183), A180 (≠ L184), A240 (= A246), T241 (≠ V247), G242 (= G248), P297 (= P299), I328 (≠ V335), F329 (= F336)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 15, 20, 23, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
33% identity, 37% coverage: 39:341/821 of query aligns to 29:334/443 of 6ruzA
- active site: V39 (≠ P49), C44 (≠ I54), E53 (= E63), E58 (= E67), Y159 (≠ L163), E163 (= E167)
- binding coenzyme a: S40 (≠ N50), Y41 (= Y51), C44 (≠ I54), R63 (≠ N72), N303 (≠ K305), R307 (= R310)
- binding flavin-adenine dinucleotide: Y33 (≠ F43), E34 (≠ G44), K35 (≠ A45), A43 (≠ R53), C44 (≠ I54), E80 (≠ R89), V81 (= V90), T113 (= T117), G114 (= G118), A115 (≠ S119), L133 (≠ F137), R134 (= R138), Y159 (≠ L163), G280 (= G284), D281 (≠ E285), P297 (= P299), L298 (= L300), G299 (≠ F301)
Sites not aligning to the query:
- active site: 425, 430
- binding coenzyme a: 15, 19, 20, 23, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 424, 425
Q9LK94 Monodehydroascorbate reductase 4, peroxisomal; AtMDAR4; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 45% coverage: 76:446/821 of query aligns to 80:457/488 of Q9LK94
- G386 (= G372) mutation to Q: In sdp2-3; loss of ascorbate recycling.
Sites not aligning to the query:
- 11 G→Q: In sdp2-2; loss of ascorbate recycling.
- 14 V→A: In sdp2-1; loss of ascorbate recycling.
- 483:488 mutation Missing: Loss of peroxisomal targeting.
- 488 mutation Missing: No effect on peroxisomal targeting.
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
30% identity, 45% coverage: 15:383/821 of query aligns to 4:382/424 of 8c0zE
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
35% identity, 30% coverage: 40:289/821 of query aligns to 31:283/409 of 3lxdA
- active site: R44 (= R53), P45 (≠ I54)
- binding flavin-adenine dinucleotide: R36 (≠ A45), E37 (= E46), R44 (= R53), P45 (≠ I54), S48 (= S57), K49 (≠ P58), E81 (≠ R89), V82 (= V90), T109 (= T117), I157 (≠ L164), G278 (= G284), D279 (≠ E285)
Sites not aligning to the query:
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
30% identity, 41% coverage: 13:349/821 of query aligns to 2:324/346 of 1xhcA
- active site: P10 (≠ M21), K38 (≠ R53), P39 (≠ I54), F145 (≠ L163), E149 (= E167), M276 (≠ F301)
- binding flavin-adenine dinucleotide: V6 (= V17), G7 (= G18), G9 (= G20), P10 (≠ M21), G11 (≠ A22), D29 (≠ G44), K30 (≠ A45), K38 (≠ R53), P39 (≠ I54), E74 (≠ R89), A75 (≠ V90), A100 (= A116), T101 (= T117), G102 (= G118), L119 (≠ F137), R120 (= R138), F145 (≠ L163), I146 (≠ L164), E149 (= E167), G259 (= G284), D260 (≠ E285), G270 (= G295), T271 (≠ L296), A272 (≠ V297)
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
31% identity, 38% coverage: 11:326/821 of query aligns to 4:318/384 of Q9HTK9
Sites not aligning to the query:
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
31% identity, 38% coverage: 11:326/821 of query aligns to 1:315/381 of 2v3aA
- active site: L11 (≠ M21), K42 (≠ R53), P43 (≠ I54), M290 (≠ F301)
- binding flavin-adenine dinucleotide: I7 (≠ V17), G8 (= G18), T9 (≠ N19), G10 (= G20), A12 (= A22), T33 (≠ G44), A34 (= A45), D35 (≠ E46), K42 (≠ R53), P43 (≠ I54), R79 (= R89), V80 (= V90), A105 (= A116), W106 (≠ T117), G107 (= G118), I153 (≠ L164), F157 (≠ A168), D274 (≠ E285), L284 (≠ G295), Y285 (≠ L296), V286 (= V297)
Sites not aligning to the query:
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
31% identity, 37% coverage: 14:316/821 of query aligns to 4:312/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G18), G10 (= G20), H11 (≠ M21), A12 (= A22), D34 (≠ A45), E35 (= E46), R42 (= R53), P43 (≠ I54), S46 (= S57), K47 (≠ P58), R78 (= R89), M79 (≠ V90), T106 (= T117), R127 (= R138), I153 (≠ L164), D275 (≠ E285), S292 (≠ L296), V293 (= V297)
Sites not aligning to the query:
5jclA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
31% identity, 37% coverage: 75:381/821 of query aligns to 78:400/429 of 5jclA
- active site: R317 (= R310)
- binding flavin-adenine dinucleotide: I93 (≠ V90), A119 (= A116), T120 (= T117), G121 (= G118), R144 (= R138), E145 (≠ D139), D295 (≠ E285), E311 (≠ A304), H312 (≠ K305), V313 (= V306), A316 (= A309), Y346 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G170 (= G162), Y171 (≠ L163), I172 (≠ L164), E175 (= E167), P192 (≠ L184), R199 (= R191), G256 (≠ A246), V257 (= V247), G258 (= G248), E311 (≠ A304), H312 (≠ K305), Y346 (vs. gap)
Sites not aligning to the query:
- active site: 13, 45, 46, 61, 65, 70, 425
- binding flavin-adenine dinucleotide: 10, 11, 12, 13, 14, 36, 37, 38, 45, 46, 50
5jciA Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. Japonica (see paper)
31% identity, 37% coverage: 75:381/821 of query aligns to 78:400/432 of 5jciA
- active site: R317 (= R310)
- binding flavin-adenine dinucleotide: I93 (≠ V90), A119 (= A116), T120 (= T117), G121 (= G118), R144 (= R138), E145 (≠ D139), Y171 (≠ L163), I172 (≠ L164), L262 (≠ N252), D295 (≠ E285), H312 (≠ K305), V313 (= V306), A316 (= A309), F345 (vs. gap), Y346 (vs. gap)
Sites not aligning to the query:
- active site: 13, 45, 46, 61, 65, 70, 428
- binding flavin-adenine dinucleotide: 10, 11, 12, 13, 14, 36, 37, 38, 45, 46, 50
Query Sequence
>AZOBR_RS18565 FitnessBrowser__azobra:AZOBR_RS18565
MSTHTNPPTPRERLVVVGNGMAGIRTLEELLAKAPDRYDITVFGAEPHPNYNRIMLSPVL
AGEKTFEQIVLNGRDWYEANGIRLLTGDRVEVIDRANCTVTAISGLTVPYDKLLIATGST
PVIIPVPGSTLTGVVGFRDLADVDTMLEAAARGGRAVVIGGGLLGLEAANGLKVKGMDVT
VLHLMDTLMERQLDRSAGALLRHELERRGITVLTGADTAEIVGSEKVSAVRLKNGQELPA
DLVVMAVGIRPNTTLGKAAGLACGRGIQVDDAMTTSDPAILSVGECVEHRGQTYGLVAPL
FEMAKVAAARLAGSAEAAYTGSVTSTKLKVTGVDVFSAGDFTGGKDCEDIVFRDAARGVY
KRVVVKENRILGAVLYGDTKDGGWYFQMLKDGTEVAPVRDTLIFGQSFGGEGAANPKAAV
AALPDSAEICGCNGVCKGTIVTAITEKGLSSLDEVRAHTKASASCGSCTGQVEQLLALTL
GDGYAGEAKAKPMCKCTDRTHDEVRRAITALDLKTIPDVMQRLEWRTPDGCHHCRPALNY
YLLCEWPGEYKDDSRSRYINERVHANIQKDGTYSVVPRMWGGLTSAKELRAIADVVDKFA
IPTVKVTGGQRIDLFGVKKEDLPAVWADLNAAGMVSGHAYAKGLRTVKTCVGSEWCRFGT
QDSTGLGVKLERMTWGTWTPHKVKLAVSGCPRNCAEATIKDLGVVCVDSGYELHVGGNGG
MHVRACDLLVKVETEAEVLEYTGAYMQLYREEARYLERTAPWVERVGLDHIRRRLVDDAE
GRAALNARFLFSQSFSQDDPWAERANGSVDRHEFAPLAQVG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory