SitesBLAST
Comparing AZOBR_RS18775 FitnessBrowser__azobra:AZOBR_RS18775 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
36% identity, 98% coverage: 6:258/259 of query aligns to 5:246/246 of 3osuA
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
39% identity, 100% coverage: 1:258/259 of query aligns to 1:247/247 of 4jroC
- active site: G16 (= G16), S142 (≠ T152), Q152 (≠ Y162), Y155 (= Y165), K159 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (= S14), R15 (= R15), G16 (= G16), I17 (= I17), N35 (= N35), Y36 (= Y36), N37 (≠ L37), G38 (≠ Q38), S39 (≠ N39), N63 (≠ D67), V64 (= V68), N90 (= N94), A91 (= A95), I93 (≠ Y99), I113 (≠ G123), S142 (≠ T152), Y155 (= Y165), K159 (= K169), P185 (= P195), I188 (≠ V198), T190 (= T201)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
35% identity, 98% coverage: 6:258/259 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G16), S138 (≠ T152), Q148 (≠ Y162), Y151 (= Y165), K155 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (= S14), R11 (= R15), I13 (= I17), N31 (= N35), Y32 (= Y36), A33 (≠ L37), G34 (≠ Q38), S35 (≠ N39), A58 (= A66), N59 (≠ D67), V60 (= V68), N86 (= N94), A87 (= A95), T109 (≠ G123), S138 (≠ T152), Y151 (= Y165), K155 (= K169), P181 (= P195), G182 (= G196)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 99% coverage: 3:258/259 of query aligns to 5:244/244 of 4nbuB
- active site: G18 (= G16), N111 (≠ A124), S139 (≠ T152), Q149 (≠ Y162), Y152 (= Y165), K156 (= K169)
- binding acetoacetyl-coenzyme a: D93 (= D102), K98 (= K107), S139 (≠ T152), N146 (≠ T159), V147 (= V160), Q149 (≠ Y162), Y152 (= Y165), F184 (≠ L197), M189 (≠ A203), K200 (≠ A214)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ R15), G18 (= G16), I19 (= I17), D38 (≠ Y36), F39 (≠ L37), V59 (≠ A66), D60 (= D67), V61 (= V68), N87 (= N94), A88 (= A95), G89 (≠ P98), I90 (≠ Y99), T137 (≠ M150), S139 (≠ T152), Y152 (= Y165), K156 (= K169), P182 (= P195), F184 (≠ L197), T185 (≠ V198), T187 (= T201), M189 (≠ A203)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
35% identity, 98% coverage: 1:255/259 of query aligns to 2:248/252 of 1vl8B
- active site: G17 (= G16), S143 (≠ T152), I154 (≠ Y162), Y157 (= Y165), K161 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), R16 (= R15), G17 (= G16), L18 (≠ I17), S37 (≠ Y36), R38 (≠ L37), C63 (≠ A66), D64 (= D67), V65 (= V68), A91 (≠ N94), A92 (= A95), G93 (≠ D102), I94 (≠ P103), V114 (≠ G123), I141 (≠ M150), S143 (≠ T152), Y157 (= Y165), K161 (= K169), P187 (= P195), G188 (= G196), Y190 (= Y199), T192 (= T201), M194 (≠ A203), T195 (≠ S204)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
40% identity, 97% coverage: 6:256/259 of query aligns to 12:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G12), S20 (= S14), K21 (≠ R15), G22 (= G16), I23 (= I17), A43 (≠ L37), S44 (≠ Q38), S45 (≠ N39), G68 (≠ A66), D69 (= D67), V70 (= V68), N96 (= N94), S97 (≠ A95), G98 (≠ R97), Y100 (= Y99), I144 (≠ M150), S146 (≠ T152), Y159 (= Y165), K163 (= K169), P189 (= P195), G190 (= G196), M191 (≠ L197), I192 (≠ V198), T194 (≠ P200), G196 (vs. gap), T197 (= T201)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (≠ T152), Y159 (= Y165), M191 (≠ L197), I202 (≠ A206)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
38% identity, 97% coverage: 5:255/259 of query aligns to 5:244/248 of 6ixmC
- active site: G16 (= G16), S142 (≠ T152), Y155 (= Y165), K159 (= K169)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S15 (≠ R15), G16 (= G16), I17 (= I17), D36 (≠ Y36), I37 (≠ L37), A61 (= A66), D62 (= D67), T63 (≠ V68), N89 (= N94), A90 (= A95), M140 (= M150), S142 (≠ T152), Y155 (= Y165), K159 (= K169), P185 (= P195), A186 (≠ G196), Y187 (≠ L197), I188 (≠ V198), L192 (≠ D202)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 100% coverage: 1:258/259 of query aligns to 1:243/244 of P0AEK2
- GASR 12:15 (= GASR 12:15) binding
- T37 (≠ Q38) binding
- NV 59:60 (≠ DV 67:68) binding
- N86 (= N94) binding
- Y151 (= Y165) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YTTAK 165:169) binding
- A154 (= A168) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K169) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ V198) binding
- E233 (≠ Q248) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
37% identity, 98% coverage: 6:258/259 of query aligns to 7:246/247 of P73574
- A14 (= A13) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P158) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K169) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ L197) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ V211) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
36% identity, 97% coverage: 5:256/259 of query aligns to 5:248/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), Q15 (≠ R15), G16 (= G16), I17 (= I17), D36 (≠ Y36), V63 (= V68), N89 (= N94), A91 (≠ Y99), S94 (≠ D102), I142 (≠ M150), S143 (≠ A151), S144 (≠ T152), Y157 (= Y165), K161 (= K169), P187 (= P195), H188 (vs. gap), I190 (≠ L197), I194 (≠ T201)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
33% identity, 99% coverage: 2:258/259 of query aligns to 1:242/243 of 1q7bA
- active site: G15 (= G16), E101 (≠ D113), S137 (≠ T152), Q147 (≠ Y162), Y150 (= Y165), K154 (= K169)
- binding calcium ion: E232 (≠ Q248), T233 (≠ V249)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (= S14), R14 (= R15), T36 (≠ Q38), N58 (≠ D67), V59 (= V68), N85 (= N94), A86 (= A95), G87 (≠ P98), I88 (≠ Y99), S137 (≠ T152), Y150 (= Y165), K154 (= K169), P180 (= P195), G181 (= G196), I183 (≠ V198)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
34% identity, 100% coverage: 1:258/259 of query aligns to 1:243/244 of 6t77A
- active site: G16 (= G16), S138 (≠ T152), Y151 (= Y165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (= S14), R15 (= R15), T37 (≠ A42), L58 (≠ A66), N59 (≠ D67), V60 (= V68), A87 (= A95), G88 (≠ P98), I89 (≠ Y99)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
33% identity, 99% coverage: 2:258/259 of query aligns to 1:242/243 of 1q7cA
- active site: G15 (= G16), S137 (≠ T152), Q147 (≠ Y162), F150 (≠ Y165), K154 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (= S14), R14 (= R15), A35 (≠ L37), T36 (≠ Q38), L57 (≠ A66), N58 (≠ D67), V59 (= V68), G87 (≠ P98), I88 (≠ Y99)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 100% coverage: 1:258/259 of query aligns to 1:243/244 of P0A2C9
- M125 (= M139) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A238) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S239) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
34% identity, 99% coverage: 3:258/259 of query aligns to 2:242/243 of 7emgB
6qheA Alcohol dehydrogenase from arthrobacter sp. Ts-15 in complex with NAD+
34% identity, 100% coverage: 1:258/259 of query aligns to 3:256/261 of 6qheA
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), M17 (≠ R15), G18 (= G16), M19 (≠ I17), D38 (≠ E41), R39 (≠ A42), D63 (= D67), I64 (≠ V68), A90 (= A100), A91 (≠ F101), S142 (≠ T152), Y156 (= Y165), K160 (= K169), P186 (= P195), G187 (= G196), M189 (≠ V198), T191 (vs. gap), P192 (vs. gap), M193 (vs. gap)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
31% identity, 100% coverage: 1:258/259 of query aligns to 4:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), S17 (= S14), R18 (= R15), I20 (= I17), T40 (≠ Q38), N62 (≠ D67), V63 (= V68), N89 (= N94), A90 (= A95), I92 (≠ R97), V139 (≠ M150), S141 (≠ T152), Y154 (= Y165), K158 (= K169), P184 (= P195), G185 (= G196), I187 (≠ V198), T189 (= T201), M191 (≠ A203)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
36% identity, 97% coverage: 5:256/259 of query aligns to 5:251/256 of 7do7A
- active site: G16 (= G16), S146 (≠ T152), Y159 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), R15 (= R15), G16 (= G16), I17 (= I17), S37 (≠ L37), D66 (= D67), A67 (≠ V68), N93 (= N94), A94 (= A95), G95 (vs. gap), I96 (≠ F96), V144 (≠ M150), S145 (≠ A151), S146 (≠ T152), Y159 (= Y165), K163 (= K169), P189 (= P195), G190 (= G196), I192 (≠ D202), T194 (≠ S204), I196 (≠ A206)
- binding beta-L-rhamnopyranose: F99 (≠ Y99), S146 (≠ T152), S148 (≠ L154), Q156 (≠ Y162), Y159 (= Y165), N197 (≠ T207), D235 (≠ G240), M236 (≠ W241), R238 (= R243)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
36% identity, 97% coverage: 5:256/259 of query aligns to 5:251/256 of 7b81A
- active site: G16 (= G16), S146 (≠ T152), Y159 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S14 (= S14), R15 (= R15), I17 (= I17), D66 (= D67), A67 (≠ V68), N93 (= N94), A94 (= A95), G95 (vs. gap), I96 (≠ F96), T116 (≠ G123), V144 (≠ M150), S146 (≠ T152), Y159 (= Y165), K163 (= K169), P189 (= P195), G190 (= G196), I192 (≠ D202), T194 (≠ S204), I196 (≠ A206)
5ts3A Crystal structure of a 3-oxoacyl-[acyl-carrier protein] reductase with bound NAD from brucella melitensis
37% identity, 99% coverage: 2:258/259 of query aligns to 16:264/265 of 5ts3A
- active site: G30 (= G16), S158 (≠ T152), V168 (= V160), Y172 (= Y165), K176 (= K169)
- binding nicotinamide-adenine-dinucleotide: G26 (= G12), R29 (= R15), G30 (= G16), I31 (= I17), D50 (≠ Y36), L51 (= L37), D77 (= D67), V78 (= V68), N101 (= N94), V129 (≠ G123), T156 (≠ M150), Y172 (= Y165), K176 (= K169), P202 (= P195), I205 (≠ V198), T207 (= T201)
Query Sequence
>AZOBR_RS18775 FitnessBrowser__azobra:AZOBR_RS18775
MDFRDKTVLVTGASRGIGAAIAKAFAAEGAAVAVNYLQNAEAAEAVAAACRDLGREAGGD
AWAVQADVTDAEAVNRMVERTAEEFGKIDVVVNNAFRPYAFDPEKRKLFWDTDWADYRGQ
VDGALLGTYNVCRAVLPVMRRRPGGSIVNMATDLVARPTVPYHDYTTAKAALVGFSRNLA
AELGPLGIRVNCVAPGLVYPTDASRATKEDVKDAIVAQTPLRRIATPEDVTGPVLFLASG
WSRFMTGQVLYVDGGLVMG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory