Comparing AZOBR_RS18880 FitnessBrowser__azobra:AZOBR_RS18880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
32% identity, 97% coverage: 1:147/152 of query aligns to 502:650/650 of O31645
Sites not aligning to the query:
P46321 Probable licABCH operon regulator; EC 2.7.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 61% coverage: 18:109/152 of query aligns to 514:601/641 of P46321
Sites not aligning to the query:
P00550 PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl; EC 2.7.1.197 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 85% coverage: 15:143/152 of query aligns to 506:633/637 of P00550
Sites not aligning to the query:
1j6tA Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
28% identity, 85% coverage: 15:143/152 of query aligns to 14:141/144 of 1j6tA
>AZOBR_RS18880 FitnessBrowser__azobra:AZOBR_RS18880
MLDLITPHAILPNLKAGSKKQALQDLARKASELTGQHERAIFDVLLERERLGTTGVGHGI
AIPHGKLPNLDRVHGVFARLERPIDFDAIDEQPVDLIFLLLAPDHAGADHLKALARVSRL
LRDQSMCEKLRGSDSADAIYALLTQHEASHAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory