Comparing AZOBR_RS19030 FitnessBrowser__azobra:AZOBR_RS19030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
54% identity, 87% coverage: 38:301/304 of query aligns to 43:311/315 of Q51742
Sites not aligning to the query:
8qeuA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with ornithine (see paper)
47% identity, 98% coverage: 4:301/304 of query aligns to 1:303/304 of 8qeuA
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
48% identity, 98% coverage: 2:300/304 of query aligns to 1:305/308 of 7nouA
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
48% identity, 98% coverage: 2:300/304 of query aligns to 1:305/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
48% identity, 98% coverage: 2:300/304 of query aligns to 1:305/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
48% identity, 98% coverage: 2:300/304 of query aligns to 1:305/308 of 7nnyA
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
48% identity, 98% coverage: 2:300/304 of query aligns to 1:305/308 of 7nnwA
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
48% identity, 98% coverage: 2:300/304 of query aligns to 1:305/308 of 7nnvA
8qevA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with carbamoyl phosphate (see paper)
45% identity, 98% coverage: 4:301/304 of query aligns to 1:296/297 of 8qevA
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
48% identity, 98% coverage: 4:300/304 of query aligns to 2:304/307 of P9WIT9
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
48% identity, 98% coverage: 4:300/304 of query aligns to 2:304/307 of 2i6uA
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
48% identity, 98% coverage: 2:300/304 of query aligns to 1:302/305 of 7np0A
7nnzB Crystal structure of mycobacterium tuberculosis argf in complex with 5-methyl-4-phenylthiazol-2-amine.
47% identity, 98% coverage: 4:300/304 of query aligns to 2:294/297 of 7nnzB
7novA Crystal structure of mycobacterium tuberculosis argf in complex with (4-methyl-3-nitrophenyl)boronic acid.
47% identity, 98% coverage: 2:300/304 of query aligns to 1:299/302 of 7novA
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
43% identity, 96% coverage: 5:296/304 of query aligns to 12:305/316 of Q81M99
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
43% identity, 96% coverage: 5:296/304 of query aligns to 8:301/307 of 4nf2A
4jqoA Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with citrulline and inorganic phosphate
39% identity, 98% coverage: 5:302/304 of query aligns to 12:338/338 of 4jqoA
4jfrB Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoyl phosphate
39% identity, 98% coverage: 5:302/304 of query aligns to 14:340/340 of 4jfrB
4jhxA Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoylphosphate and arginine
39% identity, 98% coverage: 5:302/304 of query aligns to 10:336/336 of 4jhxA
Q8DCF5 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Vibrio vulnificus (strain CMCP6)
39% identity, 98% coverage: 5:302/304 of query aligns to 8:334/334 of Q8DCF5
>AZOBR_RS19030 FitnessBrowser__azobra:AZOBR_RS19030
MSAVRHFLDIDRLDKATLRQILAMAATIKKDIPAYRSLFAGRTLAMIFEKPSTRTRVSFE
VGMRQLGGDVVVLKPDDMQLGRGETIGDTARVLSRYVDAVMVRTMGEERVHELAEFASVP
IINGLTDQSHPCQIMADVMTFEEHRGPIEGRTVAWIGDVNNVAVSWVHVAVRLGVEIRLG
CPEIYGPAPELLDWVKREGGRITVTTSPEEAVRGADCVVTDAWASMHNTDVDERAAVLGP
YQVNEALMALAAPDALFMHCLPAHRGEEVTDGVIDGRHSVVWDEAENRLHAQKAILAWCL
GATI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory