Comparing AZOBR_RS19090 FitnessBrowser__azobra:AZOBR_RS19090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 95% coverage: 4:242/252 of query aligns to 14:254/265 of P07821
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 88% coverage: 1:223/252 of query aligns to 17:235/378 of P69874
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
35% identity, 85% coverage: 1:214/252 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
34% identity, 85% coverage: 1:214/252 of query aligns to 1:223/230 of 1l2tA
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
36% identity, 88% coverage: 2:223/252 of query aligns to 4:225/350 of 3fvqB
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
32% identity, 91% coverage: 1:229/252 of query aligns to 4:223/353 of 1vciA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 89% coverage: 1:225/252 of query aligns to 2:225/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 89% coverage: 1:224/252 of query aligns to 1:224/240 of 4ymuJ
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
29% identity, 85% coverage: 1:215/252 of query aligns to 3:218/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
29% identity, 85% coverage: 1:215/252 of query aligns to 3:218/230 of 6z4wA
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 89% coverage: 1:225/252 of query aligns to 4:229/280 of 5x40A
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 88% coverage: 1:221/252 of query aligns to 3:223/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 88% coverage: 1:221/252 of query aligns to 3:223/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 88% coverage: 1:221/252 of query aligns to 3:223/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 88% coverage: 1:221/252 of query aligns to 3:223/242 of 2oljA
8g4cB Bceabs atpgs high res tm (see paper)
29% identity, 85% coverage: 5:217/252 of query aligns to 11:224/248 of 8g4cB
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 87% coverage: 1:219/252 of query aligns to 4:226/648 of P75831
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
31% identity, 87% coverage: 7:225/252 of query aligns to 32:252/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
31% identity, 87% coverage: 7:225/252 of query aligns to 32:252/382 of 7aheC
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 87% coverage: 2:221/252 of query aligns to 4:226/353 of 1oxvD
>AZOBR_RS19090 FitnessBrowser__azobra:AZOBR_RS19090
MIDVKNITKRYNGTVVLDGVSLSLPAGGVISLIGANGAGKSTLLSIISRLLPMSSGTVEI
DGLDVTTTPGEVLARRLSILRQDNQIMSRLTVEDLVAFGRYPHSKGRLTDEDRKHIAKAL
RYLDLEPLAGRFLDELSGGQRQRAFIAMVLCQDTEYILLDEPLNNLDVKHAVAMMKLFRR
TADEFGKTVVLVLHDINFASCYSDRIVAMRDGRVVHQGPPEAIITPDVIRDVYGVEAQVM
ENAGQRIALYYQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory