Comparing AZOBR_RS19250 FitnessBrowser__azobra:AZOBR_RS19250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
57% identity, 100% coverage: 1:210/210 of query aligns to 1:210/210 of 2xf4A
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
36% identity, 97% coverage: 6:209/210 of query aligns to 5:208/209 of 7ev5A
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
38% identity, 86% coverage: 29:208/210 of query aligns to 28:200/202 of 7l0bA
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
36% identity, 100% coverage: 1:209/210 of query aligns to 1:201/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
37% identity, 97% coverage: 5:208/210 of query aligns to 1:198/198 of 2zziA
3r2uB 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
28% identity, 93% coverage: 11:205/210 of query aligns to 15:210/336 of 3r2uB
Sites not aligning to the query:
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
39% identity, 49% coverage: 108:209/210 of query aligns to 111:216/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
39% identity, 49% coverage: 108:209/210 of query aligns to 95:200/237 of 4chlB
Sites not aligning to the query:
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
38% identity, 49% coverage: 108:209/210 of query aligns to 93:204/244 of 2gcuA
Sites not aligning to the query:
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 49% coverage: 108:209/210 of query aligns to 142:253/294 of Q9C8L4
Sites not aligning to the query:
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
29% identity, 90% coverage: 20:209/210 of query aligns to 22:227/473 of 3tp9A
3r2uA 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
27% identity, 93% coverage: 11:205/210 of query aligns to 13:222/348 of 3r2uA
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
34% identity, 49% coverage: 107:208/210 of query aligns to 91:196/350 of 5ve5A
Sites not aligning to the query:
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
28% identity, 88% coverage: 23:206/210 of query aligns to 23:188/225 of 4ysbA
6sg9FL uS3m (see paper)
41% identity, 38% coverage: 130:208/210 of query aligns to 220:297/320 of 6sg9FL
Sites not aligning to the query:
6aufB Crystal structure of metalo beta lactamases mim-1 from novosphingobium pentaromativorans
32% identity, 61% coverage: 52:179/210 of query aligns to 80:213/273 of 6aufB
Sites not aligning to the query:
5nggA Crystal structure of the subclass b3 metallo-beta-lactamase bjp-1 in complex with acetate anion
36% identity, 40% coverage: 52:135/210 of query aligns to 77:160/274 of 5nggA
Sites not aligning to the query:
5wcmA Crystal structure of the complex between class b3 beta-lactamase bjp-1 and 4-nitrobenzene-sulfonamide - new refinement (see paper)
36% identity, 40% coverage: 52:135/210 of query aligns to 66:149/263 of 5wcmA
Sites not aligning to the query:
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
32% identity, 81% coverage: 27:196/210 of query aligns to 38:204/283 of 2p18A
4efzA Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
31% identity, 64% coverage: 46:179/210 of query aligns to 62:204/295 of 4efzA
>AZOBR_RS19250 FitnessBrowser__azobra:AZOBR_RS19250
MQTIIVPVTPFQQNCTVLWCPETMKGAAVDPGGDLPRVLRAAQSKGVTLEKILVTHGHID
HAGAVADLADELKLPIEGPHREDQFWIDGMPMQSQMFGFPPVRSFTPDRWLEEGDTVTVG
NLTLDVHHCPGHTPGHVVFVHKPSKIAIVGDVLFQGSIGRTDFPKGNHGDLIESIRSKLF
PLGDDVTFIPGHGPTSTIGEERLYNPFLND
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory