Comparing AZOBR_RS19475 FitnessBrowser__azobra:AZOBR_RS19475 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
53% identity, 97% coverage: 1:344/354 of query aligns to 1:342/343 of P30750
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
53% identity, 97% coverage: 1:344/354 of query aligns to 2:343/344 of 3tuzC
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
53% identity, 97% coverage: 1:344/354 of query aligns to 2:343/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
53% identity, 97% coverage: 1:344/354 of query aligns to 2:343/344 of 6cvlD
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
42% identity, 67% coverage: 11:247/354 of query aligns to 8:240/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
42% identity, 70% coverage: 1:247/354 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
42% identity, 70% coverage: 1:247/354 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
42% identity, 70% coverage: 1:247/354 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
42% identity, 70% coverage: 1:247/354 of query aligns to 3:242/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
44% identity, 65% coverage: 19:248/354 of query aligns to 14:241/241 of 4u00A
Sites not aligning to the query:
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
42% identity, 63% coverage: 1:222/354 of query aligns to 1:216/222 of 8i6rB
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
40% identity, 65% coverage: 14:244/354 of query aligns to 34:264/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
40% identity, 65% coverage: 14:244/354 of query aligns to 34:264/382 of 7aheC
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
45% identity, 57% coverage: 1:202/354 of query aligns to 3:202/226 of 5xu1B
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
43% identity, 62% coverage: 1:221/354 of query aligns to 1:215/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
43% identity, 62% coverage: 1:221/354 of query aligns to 1:215/222 of P0A9R7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
43% identity, 62% coverage: 1:221/354 of query aligns to 1:215/218 of 8hd0A
7ahdC Opua (e190q) occluded (see paper)
39% identity, 64% coverage: 14:240/354 of query aligns to 34:260/260 of 7ahdC
Sites not aligning to the query:
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
43% identity, 64% coverage: 1:228/354 of query aligns to 2:226/227 of 8igqA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
43% identity, 64% coverage: 1:228/354 of query aligns to 1:225/229 of A5U7B7
>AZOBR_RS19475 FitnessBrowser__azobra:AZOBR_RS19475
MITFEQLQKTYPSRGTGQPVQALADIDLTIGRGEIYGIIGRSGAGKSTLLRTVNLLEKPT
SGRVLVDGVDVTALSARELREARHSIGMIFQHFNLLSSRTVFDNVALPLELAGVAKAQIR
ATVEPLLDLVGLTDKRDRYPAELSGGQKQRVGIARALASKPKVLLSDEATSALDPETTTQ
ILHLLADINKRLGLTIVLITHEIAVIKEICHKVAVMENGRIIEQGPVFDIFAHPKHETTK
TFVDPVINRGIPDSLRARLSATPVPGSNMVLRITFTGERATSPVISAISRKLNLDLNIWH
GQIDEIQGAPFGTLVVEAIGNPQSIEAAISLLNVNKLGVEVLGHAVPGNLRAAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory