Comparing AZOBR_RS19865 FitnessBrowser__azobra:AZOBR_RS19865 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
61% identity, 91% coverage: 27:356/362 of query aligns to 1:330/344 of 4yicA
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
60% identity, 90% coverage: 29:354/362 of query aligns to 2:327/337 of 2hzlB
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
58% identity, 98% coverage: 1:354/362 of query aligns to 1:355/365 of Q3J1R2
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
51% identity, 90% coverage: 29:354/362 of query aligns to 3:328/330 of 7ug8B
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
41% identity, 88% coverage: 32:351/362 of query aligns to 4:324/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
40% identity, 89% coverage: 33:354/362 of query aligns to 6:329/329 of 4petA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
27% identity, 89% coverage: 1:323/362 of query aligns to 4:331/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
27% identity, 75% coverage: 54:323/362 of query aligns to 25:300/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
27% identity, 75% coverage: 54:323/362 of query aligns to 25:300/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
30% identity, 65% coverage: 32:267/362 of query aligns to 2:236/315 of 4pe3A
Sites not aligning to the query:
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
24% identity, 85% coverage: 29:336/362 of query aligns to 1:303/317 of 4xf5A
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
24% identity, 80% coverage: 49:336/362 of query aligns to 22:302/315 of 4uabA
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
29% identity, 43% coverage: 54:210/362 of query aligns to 25:182/563 of 7e9yA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
22% identity, 74% coverage: 30:297/362 of query aligns to 3:267/304 of 4x8rA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
23% identity, 73% coverage: 33:297/362 of query aligns to 3:264/300 of 4n8yA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
23% identity, 68% coverage: 49:294/362 of query aligns to 19:262/301 of 4pdhA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
23% identity, 68% coverage: 49:294/362 of query aligns to 21:264/303 of 4p9kA
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
23% identity, 68% coverage: 49:294/362 of query aligns to 22:265/304 of 4pakA
Sites not aligning to the query:
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
23% identity, 69% coverage: 53:300/362 of query aligns to 22:273/306 of 4xfeA
Sites not aligning to the query:
6wgmA Crystal structure of a marine metagenome trap solute binding protein specific for pyroglutamate (sorcerer ii global ocean sampling expedition, unidentified microbe, scf7180008839099) in complex with co-purified pyroglutamate
23% identity, 68% coverage: 52:298/362 of query aligns to 24:283/304 of 6wgmA
>AZOBR_RS19865 FitnessBrowser__azobra:AZOBR_RS19865
MKRRSFLASAGVGVAASTLAAPAIAQSTPEVHWRLASSFPKSLDTIYGAADVISRRVAAI
TDNKFTIRPFASGEIVPGLQVLDAVQNGTVECGHTASYYYVGKDPTFTFDATVPFGLNAR
QQNAWILQGGGMELLREFFKGYNVVNFPAGNTGTQMGGWFRKEIKTVQDLSGLKFRIGGF
AGQVLTKLGVVPQQIAGGDIYPSLEKGTIDAAEWIGPYDDEKLGFNKVAKYYYYPGWWEG
GLNVSLLVNQQKWEELPKPYQAALEAACYEALAIMNAKYDADNPAALKRLVAGGAQLRPF
PREVMEACYKAAYELYDETAKNNPEFAKIYEPWKKFRDEEYLWFRVAENSFDNFAFTAGQ
RR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory