Comparing AZOBR_RS20490 FitnessBrowser__azobra:AZOBR_RS20490 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
59% identity, 97% coverage: 10:300/301 of query aligns to 1:291/293 of 4wjiA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
35% identity, 98% coverage: 1:295/301 of query aligns to 1:293/293 of 3gggD
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
37% identity, 94% coverage: 15:297/301 of query aligns to 7:286/286 of 3ggpA
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
36% identity, 93% coverage: 15:295/301 of query aligns to 7:285/285 of 3ggoA
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
32% identity, 93% coverage: 15:295/301 of query aligns to 3:282/365 of 6u60B
Sites not aligning to the query:
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
32% identity, 93% coverage: 15:295/301 of query aligns to 11:290/373 of 5uyyA
Sites not aligning to the query:
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
32% identity, 93% coverage: 16:295/301 of query aligns to 9:285/286 of 3b1fA
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
28% identity, 94% coverage: 15:297/301 of query aligns to 2:279/279 of 2f1kA
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
24% identity, 79% coverage: 52:289/301 of query aligns to 31:259/280 of 2pv7B
Sites not aligning to the query:
>AZOBR_RS20490 FitnessBrowser__azobra:AZOBR_RS20490
MSETAAPLAAPLFDRVAIVGVGLIGSSLARALTHYGVARQVVCADRSPEHCAKAMELGIV
ERATTDLAEALEGADLVVLATPVGAFAEVGEQLGPLLRPGMIVTDVGSVKQAVLRDVGPH
IPDGVHLIPGHPVAGTEHSGPEAGFATLFQGRWCIVTPPPGANEGAVDKVVTMWRRIGST
VELMDANHHDRVLAITSHLPHLIAYTIVGTASDLEDDTKSEVIKFSAGGFRDFTRIAASD
PVMWRDVFLNNREAVLEILQRFTEDLTALQRAIRWGEGEQLQDHFTKTRAIRRGIIDAKQ
A
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory