SitesBLAST
Comparing AZOBR_RS20515 FitnessBrowser__azobra:AZOBR_RS20515 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ykgA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with NAD+ from escherichia coli (see paper)
64% identity, 98% coverage: 1:516/526 of query aligns to 1:517/521 of 4ykgA
- active site: C345 (= C344), C348 (= C347), D349 (= D348)
- binding flavin-adenine dinucleotide: G221 (= G220), P222 (= P221), A223 (= A222), G242 (≠ A241), E243 (= E242), G247 (= G246), Q248 (= Q247), T252 (= T251), N257 (= N256), S289 (≠ R288), A290 (= A289), T322 (= T321), G323 (= G322), C348 (= C347), G487 (= G486), D488 (= D487), Q496 (= Q495), I497 (= I496)
- binding nicotinamide-adenine-dinucleotide: I361 (= I360), G364 (= G363), S366 (= S365), E385 (= E384), F386 (= F385), I449 (= I448), M467 (≠ R466), P493 (= P492)
4ykfA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with nadh from escherichia coli (see paper)
64% identity, 98% coverage: 1:516/526 of query aligns to 1:517/521 of 4ykfA
- active site: C345 (= C344), C348 (= C347), D349 (= D348)
- binding flavin-adenine dinucleotide: G221 (= G220), P222 (= P221), A223 (= A222), G242 (≠ A241), E243 (= E242), G247 (= G246), Q248 (= Q247), N257 (= N256), A290 (= A289), T322 (= T321), G323 (= G322), C348 (= C347), N454 (= N453), D488 (= D487), Q496 (= Q495), I497 (= I496)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I361 (= I360), G364 (= G363), N365 (= N364), S366 (= S365), E385 (= E384), F386 (= F385), K391 (≠ R390), I449 (= I448), M467 (≠ R466)
P35340 Alkyl hydroperoxide reductase subunit F; Alkyl hydroperoxide reductase F52A protein; EC 1.8.1.- from Escherichia coli (strain K12) (see paper)
64% identity, 98% coverage: 1:516/526 of query aligns to 1:517/521 of P35340
- K53 (≠ R54) modified: N6-acetyllysine
- K354 (= K353) modified: N6-acetyllysine
1hyuA Crystal structure of intact ahpf (see paper)
63% identity, 98% coverage: 1:516/526 of query aligns to 1:517/521 of 1hyuA
- binding flavin-adenine dinucleotide: G221 (= G220), P222 (= P221), A223 (= A222), E243 (= E242), G247 (= G246), Q248 (= Q247), N257 (= N256), S289 (≠ R288), A290 (= A289), T322 (= T321), G323 (= G322), W326 (= W325), C345 (= C344), D488 (= D487), K495 (= K494), Q496 (= Q495), I497 (= I496)
3ctyB Crystal structure of t. Acidophilum thioredoxin reductase (see paper)
40% identity, 57% coverage: 212:511/526 of query aligns to 5:300/305 of 3ctyB
- active site: A38 (vs. gap), T42 (≠ V248), L47 (≠ A253), N50 (= N256), C133 (= C344), C136 (= C347), D137 (= D348)
- binding flavin-adenine dinucleotide: V10 (≠ I217), G11 (= G218), A15 (= A222), D34 (≠ A241), K35 (≠ E242), G40 (= G246), L41 (≠ Q247), T42 (≠ V248), A45 (≠ T251), P46 (≠ M252), N50 (= N256), V82 (= V283), T110 (= T321), G111 (= G322), S154 (= S365), Q241 (≠ N453), G275 (= G486), D276 (= D487), A283 (≠ K494), Q284 (= Q495), I285 (= I496)
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
38% identity, 57% coverage: 209:506/526 of query aligns to 3:296/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G218), G14 (= G220), P15 (= P221), A16 (= A222), F34 (≠ A240), E35 (≠ A241), K36 (≠ E242), G41 (= G246), A42 (≠ Q247), V83 (≠ R288), T112 (= T321), G113 (= G322), G276 (= G486), D277 (= D487)
- binding nicotinamide-adenine-dinucleotide: G153 (= G362), G154 (= G363), S156 (= S365), Q175 (≠ E384), N176 (≠ F385), T181 (≠ R390), V238 (≠ I448)
3f8pD Structure of sulfolobus solfataricus trxr-b3 (see paper)
34% identity, 59% coverage: 206:514/526 of query aligns to 1:307/310 of 3f8pD
- active site: C135 (= C344), C138 (= C347), D139 (= D348)
- binding nicotinamide-adenine-dinucleotide: V12 (≠ I217), G13 (= G218), L14 (≠ G219), G15 (= G220), P16 (= P221), A17 (= A222), G36 (≠ A241), T38 (≠ R243), G41 (= G246), Q42 (= Q247), I82 (≠ R288), V83 (≠ A289), G111 (≠ S320), I112 (≠ T321), G113 (= G322), G277 (= G486), D278 (= D487)
3f8rA Crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two NADP molecules (see paper)
34% identity, 59% coverage: 206:514/526 of query aligns to 1:305/308 of 3f8rA
- active site: C133 (= C344), C136 (= C347), D137 (= D348)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V12 (≠ I217), G13 (= G218), L14 (≠ G219), G15 (= G220), P16 (= P221), A17 (= A222), E37 (= E242), T38 (≠ R243), G41 (= G246), Q42 (= Q247), I82 (≠ R288), V83 (≠ A289), G109 (≠ S320), I110 (≠ T321), G111 (= G322), R115 (= R326), L117 (≠ M328), D153 (≠ N364), S154 (= S365), E157 (= E368), R174 (≠ F385), R175 (≠ D386), Y184 (≠ L395), I236 (= I448), G275 (= G486), D276 (= D487), L282 (≠ V491), G283 (≠ P492), R285 (≠ K494)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
36% identity, 58% coverage: 212:514/526 of query aligns to 5:303/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G220), P14 (= P221), A15 (= A222), E34 (≠ A241), Q35 (≠ E242), G40 (= G246), Q41 (= Q247), T45 (= T251), N50 (= N256), V82 (≠ L286), T110 (= T321), G111 (= G322), Y114 (≠ W325), C136 (= C347), V242 (≠ N453), G275 (= G486), D276 (= D487), Q284 (= Q495), I285 (= I496)
3f8dA Structure of sulfolobus solfataricus thioredoxin reductase mutant c147a (see paper)
33% identity, 59% coverage: 206:514/526 of query aligns to 1:305/308 of 3f8dA
- active site: C133 (= C344), A136 (≠ C347), D137 (= D348)
- binding flavin-adenine dinucleotide: V12 (≠ I217), G13 (= G218), L14 (≠ G219), G15 (= G220), P16 (= P221), A17 (= A222), G36 (≠ A241), E37 (= E242), T38 (≠ R243), G41 (= G246), Q42 (= Q247), E45 (≠ D250), A46 (≠ T251), V49 (≠ I254), D51 (≠ N256), I82 (≠ R288), V83 (≠ A289), G109 (≠ S320), I110 (≠ T321), G111 (= G322), C133 (= C344), A136 (≠ C347), G275 (= G486), D276 (= D487), R285 (≠ K494), Q286 (= Q495), V287 (≠ I496)
5mh4A Crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) (see paper)
33% identity, 58% coverage: 212:517/526 of query aligns to 2:303/303 of 5mh4A
- active site: V34 (vs. gap), P35 (vs. gap), M39 (≠ V248), E44 (≠ A253), C130 (= C344), C133 (= C347), D134 (= D348)
- binding flavin-adenine dinucleotide: G10 (= G220), P11 (= P221), A12 (= A222), E31 (= E242), R32 (= R243), G37 (= G246), Q38 (= Q247), T42 (= T251), N47 (= N256), G77 (≠ K291), V79 (≠ I293), T107 (= T321), G108 (= G322), E155 (≠ A369), V239 (≠ N453), F242 (≠ W456), G272 (= G486), D273 (= D487), Q281 (= Q495), I282 (= I496)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I146 (= I360), G147 (= G361), G148 (= G362), G149 (= G363), D150 (≠ N364), S151 (= S365), E154 (= E368), H170 (≠ E384), R171 (≠ F385), R172 (≠ D386), R176 (= R390), V234 (≠ I448), G235 (= G449), R280 (≠ K494), Q281 (= Q495)
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
37% identity, 56% coverage: 212:508/526 of query aligns to 8:304/313 of 2q7vA
- active site: P41 (vs. gap), I45 (≠ V248), E50 (≠ A253), C141 (= C344), C144 (= C347), D145 (= D348)
- binding flavin-adenine dinucleotide: G16 (= G220), P17 (= P221), A18 (= A222), E37 (≠ A241), K38 (≠ E242), G43 (= G246), Q44 (= Q247), I45 (≠ V248), N53 (= N256), E85 (vs. gap), V86 (= V283), T118 (= T321), G119 (= G322), C144 (= C347), G282 (= G486), D283 (= D487), Q291 (= Q495), L292 (≠ I496), S295 (≠ A499)
4gcmB Crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. Aureus mu50 at 1.80 a resolution
35% identity, 58% coverage: 212:514/526 of query aligns to 5:303/309 of 4gcmB
- active site: C133 (= C344), C136 (= C347), D137 (= D348)
- binding flavin-adenine dinucleotide: G11 (= G218), G13 (= G220), P14 (= P221), A15 (= A222), E34 (= E242), R35 (= R243), G40 (= G246), Q41 (= Q247), T45 (= T251), N50 (= N256), D81 (≠ K291), I82 (≠ L292), T110 (= T321), G111 (= G322), C136 (= C347), G275 (= G486), D276 (= D487), Q284 (= Q495), I285 (= I496)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I117 (≠ M328), G151 (= G362), G152 (= G363), D153 (≠ N364), S154 (= S365), E157 (= E368), R174 (≠ F385), R175 (≠ D386), R179 (= R390), Q181 (≠ D392), I237 (= I448)
7aawA Thioredoxin reductase from bacillus cereus (see paper)
34% identity, 58% coverage: 212:514/526 of query aligns to 7:305/315 of 7aawA
- binding flavin-adenine dinucleotide: G13 (= G218), G15 (= G220), P16 (= P221), A17 (= A222), E36 (= E242), R37 (= R243), G42 (= G246), Q43 (= Q247), T47 (= T251), N52 (= N256), G82 (≠ L286), V84 (≠ R288), A111 (≠ S320), S112 (≠ T321), G113 (= G322), C138 (= C347), G277 (= G486), D278 (= D487), Q286 (= Q495), I287 (= I496)
- binding alpha-D-glucopyranose: R27 (= R232), D49 (≠ A253), K74 (≠ E278), F75 (≠ Y279), P122 (= P331), G123 (= G332), E126 (= E335), G129 (≠ N338), G131 (= G340), V132 (= V341), F143 (= F352), E206 (= E415), N208 (≠ H417)
7aawB Thioredoxin reductase from bacillus cereus (see paper)
34% identity, 58% coverage: 212:514/526 of query aligns to 4:302/311 of 7aawB
- binding flavin-adenine dinucleotide: G10 (= G218), G12 (= G220), P13 (= P221), A14 (= A222), E33 (= E242), R34 (= R243), G39 (= G246), Q40 (= Q247), T44 (= T251), N49 (= N256), G79 (≠ L286), D80 (≠ Q287), V81 (≠ R288), S109 (≠ T321), G110 (= G322), Y113 (≠ W325), C135 (= C347), G274 (= G486), D275 (= D487), Q283 (= Q495), I284 (= I496)
- binding alpha-D-glucopyranose: D46 (≠ A253), E48 (= E255), G126 (≠ N338), G128 (= G340), D136 (= D348), A138 (≠ P350), F139 (≠ L351), F139 (≠ L351), F140 (= F352)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G362), G151 (= G363), D152 (≠ N364), S153 (= S365), E156 (= E368), H172 (≠ E384), R173 (≠ F385), R174 (≠ D386), R178 (= R390), I236 (= I448)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
35% identity, 57% coverage: 213:514/526 of query aligns to 5:303/306 of 5uthA
- active site: C133 (= C344), C136 (= C347), D137 (= D348)
- binding flavin-adenine dinucleotide: I9 (= I217), G10 (= G218), S11 (≠ G219), G12 (= G220), P13 (= P221), A14 (= A222), F32 (vs. gap), E33 (≠ A240), G34 (≠ A241), Q36 (≠ R243), G39 (= G246), A40 (≠ Q247), L41 (≠ V248), N49 (= N256), D81 (≠ K291), V82 (≠ L292), M110 (≠ T321), G111 (= G322), C136 (= C347), G275 (= G486), D276 (= D487), R283 (≠ K494), Q284 (= Q495), A285 (≠ I496), A288 (= A499)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
35% identity, 57% coverage: 213:514/526 of query aligns to 4:302/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (= I217), G9 (= G218), S10 (≠ G219), G11 (= G220), P12 (= P221), A13 (= A222), E32 (≠ A240), G33 (≠ A241), Q35 (≠ R243), G38 (= G246), A39 (≠ Q247), L40 (≠ V248), T43 (= T251), N48 (= N256), D80 (≠ K291), V81 (≠ L292), M109 (≠ T321), G110 (= G322), T131 (≠ Y343), C135 (= C347), G274 (= G486), D275 (= D487), R282 (≠ K494), Q283 (= Q495), A284 (≠ I496), A287 (= A499)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R326), H115 (≠ Q327), L116 (≠ M328), R173 (≠ F385), E200 (≠ L412), I201 (≠ T413), I235 (= I448)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
35% identity, 57% coverage: 213:514/526 of query aligns to 4:302/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (= I217), G9 (= G218), S10 (≠ G219), G11 (= G220), P12 (= P221), A13 (= A222), E32 (≠ A240), G33 (≠ A241), Q35 (≠ R243), G38 (= G246), A39 (≠ Q247), L40 (≠ V248), T43 (= T251), N48 (= N256), D80 (≠ K291), V81 (≠ L292), M109 (≠ T321), G110 (= G322), T131 (≠ Y343), C135 (= C347), G274 (= G486), D275 (= D487), R282 (≠ K494), Q283 (= Q495), A284 (≠ I496), A287 (= A499)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (≠ M328), R173 (≠ F385), E200 (≠ L412), I201 (≠ T413)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
35% identity, 57% coverage: 213:514/526 of query aligns to 4:302/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G218), S10 (≠ G219), G11 (= G220), P12 (= P221), A13 (= A222), E32 (≠ A240), G33 (≠ A241), Q35 (≠ R243), G38 (= G246), A39 (≠ Q247), L40 (≠ V248), T43 (= T251), N48 (= N256), D80 (≠ K291), V81 (≠ L292), M109 (≠ T321), G110 (= G322), T131 (≠ Y343), C135 (= C347), G274 (= G486), D275 (= D487), R282 (≠ K494), Q283 (= Q495), A284 (≠ I496), A287 (= A499)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (= R326), H115 (≠ Q327), L116 (≠ M328), V148 (≠ I360), R173 (≠ F385), E200 (≠ L412), I201 (≠ T413)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
35% identity, 57% coverage: 213:514/526 of query aligns to 4:302/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (= I217), G9 (= G218), S10 (≠ G219), G11 (= G220), P12 (= P221), A13 (= A222), E32 (≠ A240), G33 (≠ A241), Q35 (≠ R243), G38 (= G246), A39 (≠ Q247), L40 (≠ V248), T43 (= T251), N48 (= N256), D80 (≠ K291), V81 (≠ L292), M109 (≠ T321), G110 (= G322), T131 (≠ Y343), C135 (= C347), G274 (= G486), D275 (= D487), R282 (≠ K494), Q283 (= Q495), A284 (≠ I496), A287 (= A499)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G362), G151 (= G363), D152 (≠ N364), S153 (= S365), E156 (= E368), H172 (≠ E384), R173 (≠ F385), R174 (≠ D386), R178 (= R390), I235 (= I448)
Query Sequence
>AZOBR_RS20515 FitnessBrowser__azobra:AZOBR_RS20515
VLDSNVKGQLKAYFDKITQPIELAASLDDGAKSQDMQALLQDIASLSDKITFVRTDDDAR
KPSFAIKRTGTDVSVRFAGLPMGHEFNSLILALLQVGGHPSKESAEVIEQVKALEGEYSF
ETYFSLSCQNCPDVVQALNLMSVLNPRIKHVAIDGALFQQEVDSRKIMAVPSIFLNGEPF
GQGRMGLEQILAKIDTGASQRDAEKIKAKDAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVSHTEGPKLATALEQHVKEYEVDVMNLQRAEKLIPAEGPGG
LIEIQLANGASLKSKTVILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRVSVI
GGGNSGVEAAIDLAGIVAEVTLIEFDSQLRADEVLQRKLRSLPNVRVITSGLTTEVHGDG
TKVTGLSYKNRNTGEVHRIDLEGIFVQIGLVPNTEWLKGSVALSPRGEIEVDARGQTSIP
GVFAAGDATTVPYKQIIIAMGEGSKAALSAFDYLIRMAPVEAVAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory