SitesBLAST
Comparing AZOBR_RS20525 FitnessBrowser__azobra:AZOBR_RS20525 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P77324 Aldehyde oxidoreductase FAD-binding subunit PaoB; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
53% identity, 97% coverage: 1:323/332 of query aligns to 1:314/318 of P77324
- 26:34 (vs. 25:33, 78% identical) binding
- T108 (= T107) binding
- C119 (= C118) binding
- C129 (= C128) binding
- C138 (= C137) binding
- C157 (= C156) binding
- D164 (= D163) binding
- I213 (= I211) binding
- K230 (= K229) binding
5g5gB Escherichia coli periplasmic aldehyde oxidase (see paper)
53% identity, 97% coverage: 1:323/332 of query aligns to 1:314/316 of 5g5gB
- binding flavin-adenine dinucleotide: K26 (≠ A25), F27 (= F26), A29 (= A28), G30 (= G29), G31 (= G30), T32 (= T31), N33 (= N32), L34 (= L33), G98 (= G97), A99 (= A98), L103 (= L102), A107 (= A106), T108 (= T107), A110 (≠ G109), G111 (= G110), N112 (= N111), L114 (= L113), Q115 (= Q114), S163 (= S162), D164 (= D163), L212 (= L210), I213 (= I211), F239 (= F238)
- binding iron/sulfur cluster: C119 (= C118), C129 (= C128), N130 (= N129), K131 (= K130), C138 (= C137), H148 (= H147), C157 (= C156), I158 (= I157), A159 (= A158)
5y6qB Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
46% identity, 98% coverage: 1:325/332 of query aligns to 1:328/330 of 5y6qB
- binding flavin-adenine dinucleotide: I26 (≠ F26), A28 (= A28), G29 (= G29), G30 (= G30), T31 (= T31), T32 (≠ N32), Q33 (≠ L33), A97 (≠ G97), A98 (= A98), I102 (≠ L102), A106 (= A106), T107 (= T107), G110 (= G110), N111 (= N111), R113 (≠ L113), Q114 (= Q114), G164 (≠ S162), D165 (= D163), I213 (≠ L210), I214 (= I211), K232 (= K229), F241 (= F238)
- binding iron/sulfur cluster: C118 (= C118), Y121 (≠ F121), C130 (= C128), N131 (= N129), C139 (= C137), A141 (= A139), C158 (= C156), I159 (= I157), A160 (= A158)
1rm6B Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
32% identity, 82% coverage: 1:272/332 of query aligns to 4:267/323 of 1rm6B
- binding flavin-adenine dinucleotide: P29 (≠ F26), G31 (≠ A28), A32 (≠ G29), G33 (= G30), T34 (= T31), D35 (≠ N32), L36 (= L33), L53 (≠ I50), V101 (≠ G97), A102 (= A98), A110 (= A106), T111 (= T107), G114 (= G110), N115 (= N111), C117 (≠ L113), Q118 (= Q114), D162 (= D163), L207 (≠ I211), V231 (≠ Y236), D232 (≠ A237), F233 (= F238)
- binding iron/sulfur cluster: C122 (= C118), F124 (≠ Y120), C138 (= C137), C146 (≠ I146), H147 (= H147), V148 (≠ A148), C155 (= C156), Y156 (≠ I157), A157 (= A158)
O33820 4-hydroxybenzoyl-CoA reductase subunit beta; 4-HBCR subunit beta; EC 1.1.7.1 from Thauera aromatica (see paper)
32% identity, 82% coverage: 1:272/332 of query aligns to 4:267/324 of O33820
- 29:36 (vs. 26:33, 38% identical) binding
- T111 (= T107) binding
- N115 (= N111) binding
- Q118 (= Q114) binding
- D162 (= D163) binding
- K224 (= K229) binding
4zohB Crystal structure of glyceraldehyde oxidoreductase (see paper)
27% identity, 89% coverage: 27:320/332 of query aligns to 30:273/274 of 4zohB
- active site: Y256 (≠ H302)
- binding flavin-adenine dinucleotide: A31 (= A28), G32 (= G29), G33 (= G30), H34 (≠ T31), S35 (≠ N32), L36 (= L33), H77 (≠ N74), I95 (≠ G97), G96 (≠ A98), V100 (≠ L102), T105 (= T107), G108 (= G110), S109 (≠ N111), S111 (≠ L113), A117 (vs. gap), D118 (= D163), L160 (= L210), V161 (≠ I211), D185 (≠ A237), F186 (= F238)
Sites not aligning to the query:
1ffuC Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
27% identity, 79% coverage: 4:265/332 of query aligns to 6:220/287 of 1ffuC
- binding flavin-adenine dinucleotide: K29 (≠ A25), L30 (≠ F26), A32 (= A28), G33 (= G29), G34 (= G30), H35 (≠ T31), S36 (≠ N32), L37 (= L33), I54 (= I50), I101 (≠ G97), A102 (= A98), G110 (≠ A106), T111 (= T107), G114 (= G110), D115 (≠ N111), A117 (≠ L113), N123 (≠ S135), D124 (≠ G136), L161 (= L205), V166 (≠ L210), M167 (≠ I211), W193 (≠ F238)
7dqxE Crystal structure of xanthine dehydrogenase family protein
28% identity, 83% coverage: 3:279/332 of query aligns to 5:235/293 of 7dqxE
- binding flavin-adenine dinucleotide: K29 (≠ A25), I30 (≠ F26), I31 (≠ V27), G33 (= G29), G34 (= G30), Q35 (≠ T31), S36 (≠ N32), L37 (= L33), H78 (≠ N74), I101 (≠ G97), A102 (= A98), I106 (≠ L102), G110 (≠ A106), T111 (= T107), G113 (= G109), G114 (= G110), S115 (≠ N111), A117 (≠ I146), A123 (= A152), E124 (≠ D163), I167 (= I211), Y193 (= Y236)
1n5wC Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
26% identity, 98% coverage: 3:326/332 of query aligns to 5:285/287 of 1n5wC
P19920 Carbon monoxide dehydrogenase medium chain; CO dehydrogenase subunit M; CO-DH M; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
26% identity, 98% coverage: 3:326/332 of query aligns to 5:285/288 of P19920
1t3qC Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
26% identity, 77% coverage: 26:281/332 of query aligns to 29:233/285 of 1t3qC
- binding flavin-adenine dinucleotide: I29 (≠ F26), A31 (= A28), G32 (= G29), G33 (= G30), Q34 (≠ T31), S35 (≠ N32), L36 (= L33), V100 (≠ G97), A101 (= A98), V105 (≠ L102), T110 (= T107), G113 (= G110), S114 (≠ N111), A116 (≠ I146), A122 (= A152), E123 (≠ D163), L166 (≠ I211), Y190 (= Y236)
Query Sequence
>AZOBR_RS20525 FitnessBrowser__azobra:AZOBR_RS20525
MRSFTYARADSAADAIGRAGASGTAFVAGGTNLLDLMKADVLRPEGLVDISRLPLDRIEE
TAEGGLRLGALARNADTAYDERVQTRYPMLSKAILAGASAQLRNMATNGGNLLQRTRCYY
FYDTATPCNKREPGSGCGAIGGVNRIHAILGASDQCIAVHPSDLCVALAALEAVVQVTGP
EGERSIPFGEFHRLPGDRPEIDTVLRPGDLITAIDLPAKGFAEHSTYLKVRDRASYAFAL
VSVAAGLEMDGGTVREARLALGGVAHKPWRDPEAEAALIGKPATPDRFRAAARVLLRDAK
GHEHNSFKIELAERAIVRALTEAAERKGAPRP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory