SitesBLAST
Comparing AZOBR_RS21115 FitnessBrowser__azobra:AZOBR_RS21115 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P22033 Methylmalonyl-CoA mutase, mitochondrial; MCM; Methylmalonyl-CoA isomerase; EC 5.4.99.2 from Homo sapiens (Human) (see 28 papers)
66% identity, 98% coverage: 11:712/717 of query aligns to 42:741/750 of P22033
- Q50 (≠ D19) binding
- I69 (≠ V39) to V: in MMAM; likely benign; dbSNP:rs115923556
- P86 (= P57) to L: in MMAM; mut0 and mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs769348060
- G87 (= G58) to E: in MMAM; mut0; dbSNP:rs1554160986
- R93 (= R64) to H: in MMAM; mut0; decreased methylmalonyl-CoA mutase activity; dbSNP:rs121918251
- G94 (= G65) to R: in MMAM; mut0; dbSNP:rs727504022; to V: in MMAM; mut- and mut0; dbSNP:rs535411418
- P95 (= P66) to R: in MMAM; mut0; dbSNP:rs190834116
- YPTM 96:99 (≠ RATM 67:70) binding
- Y100 (= Y71) to C: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs864309735
- W105 (= W76) to R: in MMAM; mut0; dbSNP:rs121918249
- TIRQY 106:110 (= TIRQY 77:81) binding
- R108 (= R79) to C: in MMAM; mut0; dbSNP:rs121918257; to G: in MMAM; mut-; to H: in MMAM; mut0; dbSNP:rs483352778
- Q109 (= Q80) to R: in MMAM; mut0; dbSNP:rs1461110052
- G133 (= G104) to R: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253828
- A137 (= A108) to V: in MMAM; mut0; dbSNP:rs941483851
- D139 (= D110) to N: in MMAM; uncertain significance; dbSNP:rs879253829
- L140 (= L111) to P: in MMAM; decreased protein expression; decreased methylmalonyl-CoA mutase activity
- A141 (= A112) to T: in MMAM; decreased protein expression; dbSNP:rs1554160730
- H143 (= H114) to Y: in MMAM; mut0
- G145 (= G116) to S: in MMAM; mut0
- S148 (= S119) to L: in MMAM; mut0; dbSNP:rs1300547552
- D156 (= D127) to N: in MMAM; mut-
- G158 (= G129) to V: in MMAM; mut0
- G161 (= G132) to R: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; to V: in MMAM; decreased protein expression
- F174 (= F145) to S: in MMAM; mut0; dbSNP:rs864309733
- M186 (= M157) to V: in MMAM; mut-; dbSNP:rs148331800
- T187 (= T158) to S: in MMAM; mut0; dbSNP:rs879253830
- N189 (= N160) to I: in MMAM; mut-; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs200908035; to K: in MMAM; mut-; dbSNP:rs1561959114
- A191 (= A162) to E: in MMAM; mut- and mut0; affects proper folding; reduced protein level; decreased methylmalonyl-CoA mutase activity; dbSNP:rs760782399
- A197 (= A168) to E: in MMAM; mut0
- G203 (≠ A174) to R: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs778702777
- E205 (= E176) natural variant: Missing (in MMAM; mut0; dbSNP:rs879253831)
- G215 (= G186) to C: in MMAM; mut- and mut0; dbSNP:rs121918258; to S: in MMAM; mut0; dbSNP:rs121918258
- TIQ 216:218 (= TIQ 187:189) binding
- Q218 (= Q189) to H: in MMAM; mut0 and mut-; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; alters thermodynamic stability; dbSNP:rs1446389693
- N219 (= N190) to Y: in MMAM; mut0; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; dbSNP:rs121918256
- R228 (= R199) binding ; to Q: in MMAM; mut0; dbSNP:rs770810987
- T230 (= T201) to I: in MMAM; mut-; to R: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253833
- Y231 (= Y202) to N: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; strong decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs864309736
- K255 (= K226) binding
- S262 (= S233) to N: in MMAM; mut0
- H265 (= H236) binding ; to Y: in MMAM; mut-
- E276 (= E247) to D: in MMAM; uncertain significance; mut-; dbSNP:rs12175488
- L281 (≠ I252) to S: in MMAM; mut0; dbSNP:rs796052007
- G284 (= G255) to E: in MMAM; mut0; dbSNP:rs879253835; to R: in MMAM; mut0; dbSNP:rs761477436
- S288 (≠ V259) to P: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs1179778233
- G291 (≠ A262) to E: in MMAM; mut0
- Q293 (≠ S264) to P: in MMAM; mut0
- RLS 304:306 (= RLS 275:277) binding
- L305 (= L276) to S: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs1554160246
- S306 (= S277) to F: in MMAM; mut0; dbSNP:rs1085307929
- W309 (≠ F280) to G: in MMAM; decreased protein expression
- G312 (= G283) to V: in MMAM; mut0; dbSNP:rs864309734
- Y316 (≠ F287) to C: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; no decreased affinity for adenosylcob(III)alamin; dbSNP:rs781474200
- A324 (= A295) to T: in MMAM; mut-; dbSNP:rs780387525
- R326 (= R297) to K: in MMAM; uncertain significance; dbSNP:rs758577372
- L328 (= L299) to F: in MMAM; mut0; affects proper folding; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; dbSNP:rs796052002; to P: in MMAM; mut0; dbSNP:rs965316043
- S344 (= S315) to F: in MMAM; mut-; affects proper folding; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin
- L346 (≠ A317) natural variant: Missing (in MMAM; mut0)
- L347 (= L318) to R: in MMAM; mut0; dbSNP:rs1026703654
- H350 (= H321) to Y: in MMAM; mut0; dbSNP:rs1407914109
- L358 (= L329) to P: in MMAM; mut0
- N366 (= N337) to S: in MMAM; mut-; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs864309737
- R369 (= R340) to C: in MMAM; mut0; dbSNP:rs772552898; to H: in MMAM; mut- and mut0; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; alters thermodynamic stability; dbSNP:rs564069299
- T370 (= T341) to P: in MMAM; mut0; dbSNP:rs368790885
- A377 (= A348) to E: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs121918250
- Q383 (= Q354) to H: in MMAM; mut0; to P: in MMAM; mut0
- H386 (= H357) to N: in MMAM; mut0; dbSNP:rs1554159937; to R: in MMAM; mut0; dbSNP:rs866933356
- T387 (= T358) to I: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability
- N388 (= N359) to H: in MMAM; mut0; dbSNP:rs766010704; to K: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253840
- S389 (≠ A360) natural variant: Missing (in MMAM; mut0)
- I412 (= I383) natural variant: Missing (in MMAM; mut0)
- P424 (= P395) to L: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253842
- G426 (= G397) to E: in MMAM; mut-; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs533755473; to R: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; strong decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs769922244
- G427 (= G398) to D: in MMAM; mut0; dbSNP:rs753288303
- G454 (= G425) to E: in MMAM; mut0
- A499 (≠ M470) to T: in dbSNP:rs2229385
- I505 (= I476) to T: in MMAM; decreased protein expression; decreased methylmalonyl-CoA mutase activity
- Q514 (= Q485) to E: in MMAM; uncertain significance; to K: in MMAM; decreased protein expression
- L518 (= L489) to P: in MMAM; mut0; dbSNP:rs864309738
- R532 (≠ A503) to H: in dbSNP:rs1141321
- A535 (≠ E506) to P: in MMAM; mut0; dbSNP:rs760183775
- A552 (= A523) to V: in MMAM; uncertain significance; dbSNP:rs879253845
- C560 (≠ A531) to Y: in MMAM; mut0; dbSNP:rs1238333040
- T566 (≠ S537) to R: in MMAM; mut0
- F573 (= F544) to S: in MMAM; mut-; affects proper folding; no effect on protein abundance; no effect on methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; does not alter thermodynamic stability; dbSNP:rs775593146
- Y587 (= Y558) to C: in MMAM; mut-
- I597 (≠ F568) to R: in MMAM; no changed in protein expression; decreased methylmalonyl-CoA mutase activity; dbSNP:rs1554158951
- P615 (= P586) to L: in MMAM; mut0; affects proper folding; reduced strongly protein level; to R: in MMAM; mut0; dbSNP:rs1554158777; to T: in MMAM; mut0; affects proper folding; reduced strongly protein level; loss of methylmalonyl-CoA mutase activity; dbSNP:rs1302409621
- R616 (= R587) to C: in MMAM; mut0; dbSNP:rs765284825
- L617 (≠ I588) to R: in MMAM; mut0; dbSNP:rs1554158775
- K621 (= K592) to N: in MMAM; mut0
- G623 (= G594) to R: in MMAM; mut0; dbSNP:rs121918254
- Q624 (= Q595) to R: in MMAM; no effect on protein abundance; dbSNP:rs768521956
- D625 (= D596) to G: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253847; to V: in MMAM; mut0; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity
- G626 (= G597) to C: in MMAM; mut-; dbSNP:rs982110849
- H627 (= H598) binding axial binding residue; to R: in MMAM; mut0; dbSNP:rs372486357
- G630 (= G601) to E: in MMAM; mut0; dbSNP:rs143023066
- V633 (= V604) to G: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; does not alter thermodynamic stability; dbSNP:rs200055428
- G637 (≠ S608) to E: in MMAM; mut-; to R: in MMAM; mut0; dbSNP:rs781501004
- F638 (= F609) to I: in MMAM; mut0
- D640 (= D611) to Y: in MMAM; mut0; dbSNP:rs865815395
- G642 (= G613) to R: in MMAM; mut-; dbSNP:rs747897332
- G648 (= G619) to D: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; strong decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs766721811
- V669 (≠ I640) to E: in MMAM; mut0; dbSNP:rs1360470463
- I671 (≠ V642) to V: in dbSNP:rs8589
- L674 (≠ Q645) to F: in MMAM; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs1164271240
- H678 (= H649) to R: in MMAM; mut-; dbSNP:rs147094927
- E684 (≠ Q655) natural variant: E -> EL (in MMAM; mut-)
- L685 (= L656) to R: in MMAM; mut-; dbSNP:rs864309739
- R694 (≠ A665) to L: in MMAM; mut-; decreased protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; to W: in MMAM; mut- and mut0; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs777758903
- M700 (≠ V671) to K: in MMAM; mut-; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs140600746
- G703 (= G674) to R: in MMAM; mut0; dbSNP:rs121918255
- G717 (= G688) to V: in MMAM; mut-; no effect on protein abundance; interferes with the binding of the cofactor to the apoenzyme; decreased methylmalonyl-CoA mutase activity; strong decreased affinity for adenosylcob(III)alamin; decreased thermodynamic stability; dbSNP:rs121918252
- G723 (= G694) to D: in MMAM; decreased protein expression; decreased methylmalonyl-CoA mutase activity; dbSNP:rs755077681
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 7:750 natural variant: Missing (in MMAM; mut-)
- 152:750 natural variant: Missing (in MMAM; mut0)
- 228:750 natural variant: Missing (in MMAM; mut0)
2xiqA Crystal structure of human methylmalonyl-coa mutase in complex with adenosylcobalamin and malonyl-coa (see paper)
66% identity, 98% coverage: 11:712/717 of query aligns to 7:706/714 of 2xiqA
- active site: Y75 (= Y81), Y229 (= Y235), H230 (= H236), K586 (= K592), D590 (= D596), H592 (= H598)
- binding cobalamin: Y75 (= Y81), L105 (= L111), H108 (= H114), A125 (= A131), R193 (= R199), E233 (= E239), G320 (= G326), W321 (≠ V327), E357 (= E363), G360 (= G366), L361 (= L367), G591 (= G597), H592 (= H598), D593 (= D599), R594 (= R600), G595 (= G601), I599 (= I605), G635 (= G641), S637 (= S643), L639 (≠ Q645), A641 (= A647), G667 (= G673), G668 (= G674), F687 (≠ Y693), G688 (= G694), T691 (= T697)
- binding malonyl-coenzyme a: Y61 (≠ R67), T63 (= T69), M64 (= M70), R68 (≠ K74), T71 (= T77), R73 (= R79), Y75 (= Y81), S150 (= S156), T152 (= T158), T181 (= T187), R193 (= R199), K220 (= K226), H230 (= H236), R269 (= R275), S271 (= S277), F273 (= F279), R313 (= R319), A314 (≠ T320), H315 (= H321), Q317 (= Q323), Q348 (= Q354)
8dyjB Crystal structure of human methylmalonyl-coa mutase in complex with adp and cob(ii)alamin (see paper)
66% identity, 98% coverage: 11:712/717 of query aligns to 6:705/708 of 8dyjB
- binding adenosine-5'-diphosphate: Y74 (= Y81), T151 (= T158), R192 (= R199), Y228 (= Y235), H229 (= H236), F272 (= F279), Q316 (= Q323), N352 (= N359), E356 (= E363), L360 (= L367), P361 (= P368)
- binding cobalamin: F102 (= F109), L104 (= L111), H107 (= H114), A124 (= A131), V191 (= V198), R192 (= R199), H229 (= H236), E232 (= E239), G319 (= G326), W320 (≠ V327), E356 (= E363), G359 (= G366), L360 (= L367), G590 (= G597), H591 (= H598), D592 (= D599), R593 (= R600), G594 (= G601), I598 (= I605), S636 (= S643), L638 (≠ Q645), A640 (= A647), G666 (= G673), G667 (= G674), V668 (= V675), F686 (≠ Y693), G687 (= G694), T690 (= T697)
8gjuJ Crystal structure of human methylmalonyl-coa mutase (mmut) in complex with methylmalonic acidemia type a protein (mmaa), coenzyme a, and gdp (see paper)
65% identity, 98% coverage: 11:712/717 of query aligns to 7:683/689 of 8gjuJ
- binding coenzyme a: Y61 (≠ R67), T63 (= T69), R68 (≠ K74), T71 (= T77), R73 (= R79), S150 (= S156), T152 (= T158), T181 (= T187), Q183 (= Q189), N222 (= N228), R269 (= R275), S271 (= S277), R313 (= R319), A314 (≠ T320), H315 (= H321), Q348 (= Q354)
6oxdA Structure of mycobacterium tuberculosis methylmalonyl-coa mutase with adenosyl cobalamin (see paper)
66% identity, 95% coverage: 25:707/717 of query aligns to 39:725/736 of 6oxdA
- active site: Y100 (= Y81), Y254 (= Y235), H255 (= H236), K610 (= K592), D614 (= D596), H616 (= H598)
- binding cobalamin: Y100 (= Y81), L130 (= L111), H133 (= H114), A150 (= A131), R218 (= R199), E258 (= E239), G344 (= G326), W345 (≠ V327), E381 (= E363), A382 (= A364), A384 (≠ G366), L385 (= L367), G615 (= G597), H616 (= H598), D617 (= D599), R618 (= R600), S661 (= S643), L663 (≠ Q645), A665 (= A647), G691 (= G673), G692 (= G674), F711 (≠ Y693), P712 (≠ G694), T715 (= T697)
- binding Itaconyl coenzyme A: Y86 (≠ R67), T88 (= T69), M89 (= M70), Q93 (≠ K74), T96 (= T77), R98 (= R79), Y100 (= Y81), S175 (= S156), T177 (= T158), T206 (= T187), R218 (= R199), H255 (= H236), R294 (= R275), S296 (= S277), F298 (= F279), R337 (= R319), T338 (= T320), H339 (= H321), Q341 (= Q323), Q372 (= Q354)
6reqA Methylmalonyl-coa mutase, 3-carboxypropyl-coa inhibitor complex (see paper)
63% identity, 95% coverage: 31:711/717 of query aligns to 37:722/727 of 6reqA
- active site: Y88 (= Y81), Y242 (= Y235), H243 (= H236), K603 (= K592), D607 (= D596), H609 (= H598)
- binding 3-carboxypropyl-coenzyme a: Y74 (≠ R67), T76 (= T69), M77 (= M70), F80 (≠ V73), R81 (≠ K74), T84 (= T77), R86 (= R79), Y88 (= Y81), S113 (= S106), S163 (= S156), T165 (= T158), T194 (= T187), R206 (= R199), H243 (= H236), R282 (= R275), S284 (= S277), F286 (= F279), H327 (= H321), Q329 (= Q323), Q360 (= Q354)
- binding cobalamin: Y88 (= Y81), F116 (= F109), L118 (= L111), H121 (= H114), A138 (= A131), R206 (= R199), E246 (= E239), G332 (= G326), W333 (≠ V327), E369 (= E363), A370 (= A364), A372 (≠ G366), G608 (= G597), H609 (= H598), D610 (= D599), R611 (= R600), G612 (= G601), I616 (= I605), Y620 (≠ F609), S654 (= S643), L656 (≠ Q645), G658 (≠ A647), G684 (= G673), G685 (= G674), Y704 (= Y693), T705 (≠ G694), T708 (= T697)
P11653 Methylmalonyl-CoA mutase large subunit; MCM-alpha; EC 5.4.99.2 from Propionibacterium freudenreichii subsp. shermanii (see 4 papers)
63% identity, 95% coverage: 31:711/717 of query aligns to 38:723/728 of P11653
- Y75 (≠ R67) binding
- M78 (= M70) binding
- R82 (≠ K74) binding
- T85 (= T77) binding
- R87 (= R79) binding
- Y89 (= Y81) binding ; mutation to F: Does not significantly affect affinity for succiny-CoA, but kcat is lowered about 580-fold.
- S114 (= S106) binding
- F117 (= F109) binding
- A139 (= A131) binding
- T195 (= T187) binding
- Q197 (= Q189) binding
- V206 (= V198) binding
- R207 (= R199) binding ; binding
- H244 (= H236) binding
- R283 (= R275) binding
- S285 (= S277) binding
- G333 (= G326) binding
- E370 (= E363) binding
- A373 (≠ G366) binding
- G609 (= G597) binding
- H610 (= H598) binding axial binding residue
- D611 (= D599) binding
- R612 (= R600) binding
- S655 (= S643) binding
- L657 (≠ Q645) binding
- G686 (= G674) binding
- T709 (= T697) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4reqA Methylmalonyl-coa mutase substrate complex (see paper)
63% identity, 95% coverage: 31:711/717 of query aligns to 36:721/726 of 4reqA
- active site: Y87 (= Y81), Y241 (= Y235), H242 (= H236), K602 (= K592), D606 (= D596), H608 (= H598)
- binding cobalamin: Y87 (= Y81), L117 (= L111), A137 (= A131), V204 (= V198), R205 (= R199), H242 (= H236), E245 (= E239), G331 (= G326), W332 (≠ V327), E368 (= E363), A369 (= A364), A371 (≠ G366), L372 (= L367), G607 (= G597), H608 (= H598), D609 (= D599), R610 (= R600), G611 (= G601), I615 (= I605), S653 (= S643), L655 (≠ Q645), G683 (= G673), G684 (= G674), V685 (= V675), Y703 (= Y693), T704 (≠ G694), T707 (= T697)
- binding methylmalonyl-coenzyme a: Y73 (≠ R67), M76 (= M70), F79 (≠ V73), R80 (≠ K74), T83 (= T77), R85 (= R79), Y87 (= Y81), S112 (= S106), S162 (= S156), T164 (= T158), T193 (= T187), R205 (= R199), N234 (= N228), Y241 (= Y235), H242 (= H236), R281 (= R275), S283 (= S277), F285 (= F279), H326 (= H321), Q328 (= Q323), Q359 (= Q354), S360 (= S355)
- binding succinyl-coenzyme a: Y73 (≠ R67), M76 (= M70), F79 (≠ V73), R80 (≠ K74), T83 (= T77), R85 (= R79), Y87 (= Y81), S162 (= S156), T164 (= T158), T193 (= T187), Q195 (= Q189), R205 (= R199), N234 (= N228), Y241 (= Y235), H242 (= H236), R281 (= R275), S283 (= S277), F285 (= F279), R324 (= R319), H326 (= H321), Q359 (= Q354)
7reqA Methylmalonyl-coa mutase, 2-carboxypropyl-coa inhibitor complex (see paper)
63% identity, 95% coverage: 31:711/717 of query aligns to 35:720/725 of 7reqA
- active site: Y86 (= Y81), Y240 (= Y235), H241 (= H236), K601 (= K592), D605 (= D596), H607 (= H598)
- binding 2-carboxypropyl-coenzyme a: Y72 (≠ R67), T74 (= T69), M75 (= M70), F78 (≠ V73), R79 (≠ K74), T82 (= T77), R84 (= R79), Y86 (= Y81), S161 (= S156), T163 (= T158), T192 (= T187), R204 (= R199), H241 (= H236), R280 (= R275), S282 (= S277), F284 (= F279), H325 (= H321), Q358 (= Q354)
- binding cobalamin: Y86 (= Y81), L116 (= L111), A136 (= A131), R204 (= R199), E244 (= E239), G330 (= G326), W331 (≠ V327), E367 (= E363), A368 (= A364), A370 (≠ G366), G606 (= G597), H607 (= H598), D608 (= D599), R609 (= R600), G610 (= G601), I614 (= I605), S652 (= S643), L654 (≠ Q645), G682 (= G673), G683 (= G674), Y702 (= Y693), T703 (≠ G694), T706 (= T697)
3reqA Methylmalonyl-coa mutase, substrate-free state (poor quality structure) (see paper)
63% identity, 95% coverage: 31:711/717 of query aligns to 35:720/725 of 3reqA
- active site: Y86 (= Y81), Y240 (= Y235), H241 (= H236), K601 (= K592), D605 (= D596), H607 (= H598)
- binding adenosine: Y86 (= Y81), Y240 (= Y235), E244 (= E239), G330 (= G326)
- binding cobalamin: L116 (= L111), V203 (= V198), R204 (= R199), E244 (= E239), G330 (= G326), W331 (≠ V327), A368 (= A364), G606 (= G597), H607 (= H598), D608 (= D599), R609 (= R600), G610 (= G601), I614 (= I605), G650 (= G641), S652 (= S643), L654 (≠ Q645), G682 (= G673), G683 (= G674), Y702 (= Y693), T703 (≠ G694), P704 (= P695), T706 (= T697)
2reqA Methylmalonyl-coa mutase, non-productive coa complex, in open conformation representing substrate-free state (see paper)
63% identity, 95% coverage: 31:711/717 of query aligns to 35:720/725 of 2reqA
- active site: Y86 (= Y81), Y240 (= Y235), H241 (= H236), K601 (= K592), D605 (= D596), H607 (= H598)
- binding cobalamin: V203 (= V198), R204 (= R199), E244 (= E239), A245 (= A240), W331 (≠ V327), A368 (= A364), G606 (= G597), H607 (= H598), D608 (= D599), R609 (= R600), G610 (= G601), I614 (= I605), G650 (= G641), S652 (= S643), L654 (≠ Q645), A655 (= A646), G682 (= G673), G683 (= G674), Y702 (= Y693), T703 (≠ G694), T706 (= T697)
- binding coenzyme a: Y72 (≠ R67), R79 (≠ K74), K318 (≠ R314)
5reqA Methylmalonyl-coa mutase, y89f mutant, substrate complex (see paper)
63% identity, 95% coverage: 31:711/717 of query aligns to 35:720/725 of 5reqA
- active site: F86 (≠ Y81), Y240 (= Y235), H241 (= H236), K601 (= K592), D605 (= D596), H607 (= H598)
- binding cobalamin: L116 (= L111), A136 (= A131), R204 (= R199), H241 (= H236), E244 (= E239), G330 (= G326), W331 (≠ V327), E367 (= E363), A368 (= A364), A370 (≠ G366), G606 (= G597), H607 (= H598), D608 (= D599), R609 (= R600), G610 (= G601), I614 (= I605), S652 (= S643), L654 (≠ Q645), G682 (= G673), G683 (= G674), V684 (= V675), Y702 (= Y693), T703 (≠ G694), T706 (= T697)
- binding methylmalonyl(carbadethia)-coenzyme a: Y72 (≠ R67), T74 (= T69), M75 (= M70), R79 (≠ K74), T82 (= T77), R84 (= R79), F86 (≠ Y81), S111 (= S106), S161 (= S156), T163 (= T158), T192 (= T187), Q194 (= Q189), R204 (= R199), N233 (= N228), H241 (= H236), R280 (= R275), S282 (= S277), F284 (= F279), T324 (= T320), H325 (= H321), Q358 (= Q354), S359 (= S355)
- binding succinyl(carbadethia)-coenzyme a: Y72 (≠ R67), T74 (= T69), M75 (= M70), R79 (≠ K74), T82 (= T77), R84 (= R79), F86 (≠ Y81), S161 (= S156), T163 (= T158), T192 (= T187), R204 (= R199), N233 (= N228), H241 (= H236), R280 (= R275), S282 (= S277), F284 (= F279), H325 (= H321), Q358 (= Q354)
1e1cA Methylmalonyl-coa mutase h244a mutant (see paper)
63% identity, 95% coverage: 31:711/717 of query aligns to 37:722/727 of 1e1cA
- active site: Y88 (= Y81), Y242 (= Y235), A243 (≠ H236), K603 (= K592), D607 (= D596), H609 (= H598)
- binding cobalamin: Y88 (= Y81), L118 (= L111), H121 (= H114), A138 (= A131), V205 (= V198), R206 (= R199), E246 (= E239), G332 (= G326), W333 (≠ V327), E369 (= E363), A370 (= A364), A372 (≠ G366), L373 (= L367), G608 (= G597), H609 (= H598), D610 (= D599), R611 (= R600), G612 (= G601), I616 (= I605), Y620 (≠ F609), S654 (= S643), L656 (≠ Q645), G684 (= G673), G685 (= G674), V686 (= V675), Y704 (= Y693), T705 (≠ G694), T708 (= T697), S713 (≠ A702)
- binding desulfo-coenzyme a: Y74 (≠ R67), M77 (= M70), F80 (≠ V73), R81 (≠ K74), T84 (= T77), R86 (= R79), S113 (= S106), S163 (= S156), T165 (= T158), T194 (= T187), R282 (= R275), S284 (= S277), H327 (= H321), Q360 (= Q354)
I3VE77 2-hydroxyisobutanoyl-CoA mutase large subunit; 2-hydroxyisobutyryl-CoA mutase large subunit; HCM large subunit; EC 5.4.99.64 from Aquincola tertiaricarbonis (see 2 papers)
46% identity, 70% coverage: 39:541/717 of query aligns to 46:550/562 of I3VE77
- YPTM 76:79 (≠ RATM 67:70) binding
- TMR 86:88 (≠ TIR 77:79) binding
- I90 (≠ Y81) mutation to A: 6-fold decrease in catalytic efficiency with 2-hydroxyisobutyryl-CoA as substrate. 320-fold decrease in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. 6-fold increase in catalytic efficiency with (R)-3-hydroxybutyryl-CoA as substrate. No change in catalytic efficiencies with pivalyl-CoA and isovaleryl-CoA as substrates.; mutation I->F,Y: Loss of activity.; mutation to L: 37-fold decrease in catalytic efficiency with 2-hydroxyisobutyryl-CoA as substrate. 290-fold decrease in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. Does not show any significant activities with pivalyl-CoA and isovaleryl-CoA.; mutation to V: 100-fold decrease in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. No change in catalytic efficiencies with pivalyl-CoA and isovaleryl-CoA as substrates.
- D117 (≠ A108) binding ; mutation to A: 2-fold increase in catalytic efficiency with 2-hydroxyisobutyryl-CoA as substrate. Small increase in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. 1800-fold increase in catalytic efficiency with (R)-3-hydroxybutyryl-CoA as substrate.; mutation to V: 1.5-fold increase in catalytic efficiency with 2-hydroxyisobutyryl-CoA as substrate. 3-fold decrease in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. 1300-fold increase in catalytic efficiency with (R)-3-hydroxybutyryl-CoA as substrate. 74-fold increase in catalytic efficiency with pivalyl-CoA as substrate.
- TVQ 196:198 (≠ TIQ 187:189) binding
- R235 (≠ K226) binding
- N240 (≠ S231) binding
- H245 (= H236) binding
- R284 (= R275) binding
4r3uA Crystal structure of 2-hydroxyisobutyryl-coa mutase (see paper)
46% identity, 70% coverage: 39:541/717 of query aligns to 45:549/557 of 4r3uA
- active site: I89 (≠ Y81), Y243 (= Y235), H244 (= H236)
- binding 3-hydroxybutanoyl-coenzyme a: Y75 (≠ R67), T77 (= T69), M78 (= M70), R82 (≠ K74), T85 (= T77), R87 (= R79), I89 (≠ Y81), D116 (≠ A108), S164 (= S156), T166 (= T158), T195 (= T187), Q197 (= Q189), R234 (≠ K226), N236 (= N228), N239 (≠ S231), Y243 (= Y235), H244 (= H236), R283 (= R275), F287 (= F279), R327 (= R319), F328 (≠ T320), H329 (= H321), Q331 (= Q323), Q362 (= Q354)
- binding S-{(3R,5R,9R)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9-trihydroxy-8,8-dimethyl-3,5-dioxido-10,14-dioxo-2,4,6-trioxa-11,15-diaza-3lambda~5~,5lambda~5~-diphosphaheptadecan-17-yl} 2-hydroxy-2-methylpropanethioate: Y75 (≠ R67), T77 (= T69), M78 (= M70), R82 (≠ K74), T85 (= T77), R87 (= R79), I89 (≠ Y81), D116 (≠ A108), S164 (= S156), T166 (= T158), T195 (= T187), Q197 (= Q189), R234 (≠ K226), N236 (= N228), N239 (≠ S231), H244 (= H236), R283 (= R275), F287 (= F279), R327 (= R319), F328 (≠ T320), H329 (= H321), Q331 (= Q323), Q362 (= Q354)
- binding cobalamin: D116 (≠ A108), M119 (≠ L111), E139 (≠ A131), Q207 (≠ R199), E209 (≠ T201), E247 (= E239), A334 (≠ G326), E371 (= E363), A372 (= A364), A374 (≠ G366)
5cjwA Isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate pivalyl-coenzyme a (see paper)
36% identity, 69% coverage: 48:540/717 of query aligns to 539:1052/1063 of 5cjwA
- active site: F571 (≠ Y81), Y752 (= Y235), H753 (= H236)
- binding pivalyl-coenzyme A: F558 (≠ R67), F560 (≠ T69), R562 (≠ Y71), R569 (= R79), F571 (≠ Y81), R595 (≠ Q102), S650 (= S156), T652 (= T158), R701 (≠ S185), T703 (= T187), Q705 (= Q189), Y745 (≠ N228), Y752 (= Y235), H753 (= H236), S794 (= S277), F796 (= F279), R829 (= R314), K834 (≠ R319), H836 (= H321)
- binding cobalamin: F600 (= F109), L605 (≠ H114), S623 (≠ A131), Q715 (≠ R199), H753 (= H236), E756 (= E239), A757 (= A240), G841 (= G326), R842 (≠ V327), E878 (= E363), A879 (= A364), T881 (≠ G366), H966 (≠ D451)
Sites not aligning to the query:
- active site: 6
- binding cobalamin: 18, 19, 20, 21, 22, 26, 66, 67, 94, 96, 98, 116, 117, 118
- binding guanosine-5'-diphosphate: 199, 201, 202, 203, 204, 245, 337, 338, 340, 375, 377, 1062
- binding magnesium ion: 203, 229, 242, 242, 290, 290
5cjvA Isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate isovaleryl-coenzyme a (see paper)
36% identity, 69% coverage: 48:540/717 of query aligns to 537:1050/1061 of 5cjvA
- active site: F569 (≠ Y81), Y750 (= Y235), H751 (= H236)
- binding cobalamin: F598 (= F109), L603 (≠ H114), S621 (≠ A131), Q713 (≠ R199), E754 (= E239), A755 (= A240), G839 (= G326), R840 (≠ V327), E876 (= E363), A877 (= A364), T879 (≠ G366), H964 (≠ D451)
- binding guanosine-5'-diphosphate: E944 (≠ D431)
- binding Isovaleryl-coenzyme A: F556 (≠ R67), F558 (≠ T69), R560 (≠ Y71), R567 (= R79), F569 (≠ Y81), R593 (≠ Q102), S648 (= S156), T650 (= T158), R699 (≠ S185), T701 (= T187), Q703 (= Q189), Q713 (≠ R199), Y743 (≠ N228), H751 (= H236), S792 (= S277), F794 (= F279), K832 (≠ R319), H834 (= H321)
Sites not aligning to the query:
- active site: 6
- binding cobalamin: 18, 19, 20, 21, 22, 26, 66, 67, 94, 96, 98, 116, 117, 129
- binding guanosine-5'-diphosphate: 199, 201, 202, 203, 204, 245, 336, 338, 373, 375
- binding magnesium ion: 203, 229, 242, 242, 288, 288
Q5KUG0 Fused isobutyryl-CoA mutase; EC 5.4.99.13; EC 3.6.5.- from Geobacillus kaustophilus (strain HTA426) (see paper)
34% identity, 75% coverage: 6:540/717 of query aligns to 501:1075/1086 of Q5KUG0
Sites not aligning to the query:
- 213 K→A: Loss of GTPase and ATPase activities. No effect on the mutase activity.
5cjtA Isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate isobutyryl-coenzyme a (see paper)
36% identity, 69% coverage: 48:540/717 of query aligns to 537:1051/1062 of 5cjtA
- active site: F569 (≠ Y81), Y750 (= Y235), H751 (= H236)
- binding cobalamin: F598 (= F109), L603 (≠ H114), S621 (≠ A131), Q713 (≠ R199), H751 (= H236), E754 (= E239), A755 (= A240), G839 (= G326), R840 (≠ V327), E876 (= E363), A877 (= A364), T879 (≠ G366), H964 (≠ D451)
- binding isobutyryl-coenzyme a: F556 (≠ R67), F558 (≠ T69), R560 (≠ Y71), R567 (= R79), F569 (≠ Y81), R593 (≠ Q102), S648 (= S156), T650 (= T158), R699 (≠ S185), T701 (= T187), Q703 (= Q189), Y743 (≠ N228), Y750 (= Y235), H751 (= H236), S792 (= S277), F794 (= F279), R827 (= R314), K832 (≠ R319), H834 (= H321)
- binding guanosine-5'-diphosphate: E944 (≠ D431)
Sites not aligning to the query:
- active site: 6
- binding cobalamin: 18, 19, 20, 21, 22, 26, 66, 67, 94, 96, 98, 116, 117
- binding guanosine-5'-diphosphate: 199, 201, 202, 203, 204, 245, 336, 337, 339, 374, 376
- binding magnesium ion: 203, 229, 242, 242, 289, 289
4xc6A Isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, and mg (holo-icmf/gdp) (see paper)
36% identity, 69% coverage: 48:540/717 of query aligns to 540:1056/1067 of 4xc6A
- active site: F572 (≠ Y81), Y753 (= Y235), H754 (= H236)
- binding cobalamin: F601 (= F109), L606 (≠ H114), S624 (≠ A131), Q716 (≠ R199), H754 (= H236), E757 (= E239), A758 (= A240), G842 (= G326), R843 (≠ V327), E879 (= E363), A880 (= A364), T882 (≠ G366), H967 (≠ D451)
- binding guanosine-5'-diphosphate: E947 (≠ D431)
Sites not aligning to the query:
- active site: 6
- binding cobalamin: 18, 19, 20, 21, 22, 26, 66, 67, 94, 96, 98, 116, 117, 118, 129
- binding guanosine-5'-diphosphate: 199, 201, 202, 203, 204, 245, 337, 338, 340, 375, 377
- binding magnesium ion: 203, 229, 242, 242, 290, 290
Query Sequence
>AZOBR_RS21115 FitnessBrowser__azobra:AZOBR_RS21115
MSEFPKKTQADWQTLAAKDLGANGTLEDLVWKTPEGLDVKALYTADDLEGLELDSLPGFP
PFTRGPRATMYAVKPWTIRQYAGFSTAEDSNAFYKANLKAGQMGLSVAFDLATHRGYDSD
HPRVVGDVGKAGVAIDSVEDMKILFDGIPLDKMSVSMTMNGAVLPILAGYIVAAEEQGVS
QDKLSGTIQNDILKEFMVRNTYIYPPEPSMRIIADIIEYTALNMPKFNSISISGYHMQEA
GATAVQELAFTIADGLEYVRAAMSKGLPVDKFAPRLSFFFSIGMNFFMEIAKLRAARLLW
STLMKQKFDPKDARSLALRTHCQTSGVSLTEQDPYNNVIRTTIEAMAAVLGGTQSLHTNA
FDEALGLPTKFSARIARNTQLIIAEESGVTNVVDPLGGSYYIENLTHSLANAALDLINKV
EDLGGMTKAVDSGMPKLLIEEAAARRQARVDRAEEVIVGVNKYRPENPEMVDVLDIDNTA
VRESQIARLNSVRANRDDAKCRAALEALTKAATEKSGNLLALAVEATRARATVGEISDAL
EKAFTRHVAVIRSVSGVYGAAYEGDEGFKRIQEEVSAFAAEEGRRPRILVVKMGQDGHDR
GAKVIATSFADIGFDVDIGPLFQTPEEAARQAVENDVHVIGVSSQAAGHKTLVPQLVEEL
RRQGAGDILVVCGGVIPPQDYDYLYKAGAAAIYGPGTNIPKAASDILAILRKQKAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory