SitesBLAST
Comparing AZOBR_RS21140 FitnessBrowser__azobra:AZOBR_RS21140 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
30% identity, 93% coverage: 11:414/433 of query aligns to 11:421/425 of O59010
- S65 (≠ T63) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S274) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 274:276) binding
- M311 (≠ L309) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T312) binding
- V355 (= V353) binding
- D394 (≠ S387) binding
- M395 (≠ E388) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R390) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N394) binding
- D405 (≠ N398) mutation to N: Strongly decreased affinity for aspartate.
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
30% identity, 93% coverage: 9:410/433 of query aligns to 9:417/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L44), F46 (≠ L44), P75 (≠ D73), L91 (≠ I90), F95 (= F94), L130 (≠ T136), I133 (≠ F139), I159 (≠ V165), Y167 (≠ A173), K196 (≠ G194), G200 (≠ I198), I207 (≠ L205), F210 (= F208), L250 (≠ I248), I262 (≠ L260), M269 (≠ L267), T334 (= T332), V335 (≠ I333), G336 (≠ W334), T340 (= T338), L343 (≠ G341), M399 (≠ I392)
- binding aspartic acid: S277 (= S275), S278 (= S276), T314 (= T312), G354 (≠ A352), A358 (≠ G356), G359 (= G357), D394 (≠ S387), R397 (= R390), T398 (≠ A391)
- binding sodium ion: Y89 (≠ F88), T92 (≠ V91), S93 (≠ T92), G306 (= G304), T308 (≠ S306), N310 (= N308), N310 (= N308), M311 (≠ L309), D312 (= D310), S349 (= S347), I350 (≠ K348), T352 (≠ A350), N401 (= N394), V402 (≠ L395), D405 (≠ N398)
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
30% identity, 92% coverage: 11:409/433 of query aligns to 2:407/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
30% identity, 93% coverage: 9:409/433 of query aligns to 6:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G67), V83 (≠ I85), I157 (= I166), Y164 (≠ A173), K193 (≠ G194), T305 (≠ S306), I306 (≠ F307), I347 (≠ K348)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L16), M199 (= M200), S275 (= S276), T311 (= T312), G356 (= G357), L384 (= L380), D391 (≠ S387), R394 (= R390)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
30% identity, 93% coverage: 9:410/433 of query aligns to 1:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
30% identity, 93% coverage: 9:409/433 of query aligns to 1:408/408 of 6bauA
- binding cysteine: S270 (= S276), M303 (≠ L309), T306 (= T312), A345 (= A351), G346 (≠ A352), V347 (= V353), G351 (= G357), D386 (≠ S387), C389 (≠ R390), T390 (≠ A391), N393 (= N394)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
31% identity, 91% coverage: 27:420/433 of query aligns to 23:425/425 of 6zgbA
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
31% identity, 91% coverage: 27:420/433 of query aligns to 25:427/427 of 5e9sA
- binding aspartic acid: R274 (≠ S274), S275 (= S275), S276 (= S276), T313 (= T312), G353 (≠ A352), V354 (= V353), A357 (≠ G356), G358 (= G357), D394 (≠ S387), R397 (= R390), T398 (≠ A391)
- binding decyl-beta-d-maltopyranoside: L194 (≠ G194), G198 (≠ I198), Y202 (≠ V202)
- binding sodium ion: Y87 (≠ F88), T90 (≠ V91), S91 (≠ T92), S276 (= S276), G305 (= G304), A306 (≠ Y305), T307 (≠ S306), N309 (= N308), N309 (= N308), M310 (≠ L309), D311 (= D310), S348 (= S347), I349 (≠ K348), G350 (= G349), T351 (≠ A350), N401 (= N394), V402 (≠ L395), D405 (≠ N398)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
31% identity, 91% coverage: 27:420/433 of query aligns to 22:424/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ G194), G195 (≠ I198), R282 (≠ E285)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S274), S272 (= S275), S273 (= S276), M307 (≠ L309), T310 (= T312), G353 (= G355), A354 (≠ G356), R394 (= R390), T395 (≠ A391)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
31% identity, 91% coverage: 27:419/433 of query aligns to 25:426/426 of 6xwnB
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
30% identity, 91% coverage: 27:420/433 of query aligns to 18:416/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S274), S265 (= S276), M299 (≠ L309), T302 (= T312), T340 (≠ A350), G342 (≠ A352), V343 (= V353), G347 (= G357), D383 (≠ S387), R386 (= R390), T387 (≠ A391), N390 (= N394)
- binding decyl-beta-d-maltopyranoside: H23 (= H32), V212 (≠ L223), A216 (≠ G227)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
29% identity, 93% coverage: 9:409/433 of query aligns to 1:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
29% identity, 90% coverage: 27:417/433 of query aligns to 33:411/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V77), G89 (= G78), G92 (= G81), A95 (= A84), V96 (≠ I85), Y99 (≠ F88), M163 (≠ V165), F167 (≠ V169), F293 (≠ L299), V297 (≠ T303)
- binding aspartic acid: S268 (= S275), S269 (= S276), T306 (= T312), G346 (≠ A352), I347 (≠ V353), A350 (≠ G356), G351 (= G357), D380 (≠ S387), R383 (= R390), T384 (≠ A391)
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
29% identity, 88% coverage: 45:427/433 of query aligns to 79:504/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 90% coverage: 27:417/433 of query aligns to 25:397/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I68), S80 (≠ V77), G81 (= G78), G84 (= G81), Y91 (≠ F88), M156 (≠ V165), F160 (≠ V169), F286 (≠ L299), V290 (≠ T303)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V60), I148 (≠ M157), S262 (= S276), S263 (≠ E277), A292 (≠ Y305), T293 (≠ S306), M296 (≠ L309), T299 (= T312), G329 (= G349), A336 (≠ G356), G337 (= G357), D366 (≠ S387), R369 (= R390), N373 (= N394)
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
30% identity, 87% coverage: 45:420/433 of query aligns to 43:416/416 of 8cuaA
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
30% identity, 84% coverage: 45:409/433 of query aligns to 40:402/406 of 8ctcA
- binding glutamic acid: S268 (= S275), S269 (= S276), M303 (≠ L309), T306 (= T312), G346 (≠ A352), A350 (≠ G356), D380 (≠ S387), R383 (= R390)
- binding sodium ion: Y82 (≠ F88), T85 (≠ V91), T86 (= T92), S269 (= S276), G298 (= G304), A299 (≠ Y305), T300 (≠ S306), N302 (= N308), N302 (= N308), M303 (≠ L309), D304 (= D310), S341 (= S347), I342 (≠ K348), G343 (= G349), A344 (= A350), N387 (= N394), D391 (≠ N398)
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
29% identity, 87% coverage: 45:419/433 of query aligns to 43:433/433 of 8cv2A
- binding sodium ion: Y85 (≠ F88), T88 (≠ V91), T89 (= T92), G319 (= G304), A320 (≠ Y305), N323 (= N308), N323 (= N308), M324 (≠ L309), D325 (= D310), N408 (= N394), D412 (≠ N398)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
29% identity, 85% coverage: 45:413/433 of query aligns to 47:419/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S275), S281 (= S276), T318 (= T312), G363 (= G357), M367 (≠ L361), V385 (≠ L380), D388 (= D383), R395 (= R390), T396 (≠ A391)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R384)
- binding cholesterol hemisuccinate: R80 (≠ K79), R84 (≠ K83), I95 (≠ F94), I252 (≠ F240)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
29% identity, 85% coverage: 45:413/433 of query aligns to 46:420/425 of 7xr4A
Query Sequence
>AZOBR_RS21140 FitnessBrowser__azobra:AZOBR_RS21140
MHAQGQPQKKPFYTNLTVQVLTAITIGILLGHFYPALAVQMKPLGDVFIKMIKMVIGPIV
FLTVVTGISSIGDMKKVGKVGGKAILYFEIVTTFALGLGLLVVNLVKPGSGMNIQAGSLK
ADAVAKYATEAQNHTTIDFLVNIVPDNVIGAFVKGDMLQILFFAVIFGVALSAMGQKGKV
VEDMFEKVSHALFGVIGILMRVAPLGAFGAMSFTIGKYGVSSLTSLGQLMAAVYITMALF
VFVVLGSIARLYNFSLLTFLRYIKDELLIVLGTSSSESVLPRMMEKMQKFGCSKHVVGLV
IPTGYSFNLDGTSIYLSMAAIFIAQAFNIDLTIWQQLTILGLLMLTSKGAAAVTGGGFVT
LAATLSATGHLPIEGLALLLGVDRFMSEARAITNLIGNGVATIVVAKMEGEFDESKAVAE
YQEHFKEPALARI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory