Comparing AZOBR_RS21145 FitnessBrowser__azobra:AZOBR_RS21145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
58% identity, 98% coverage: 1:753/772 of query aligns to 1:755/759 of P76558
6zngF Maeb full-length acetyl-coa bound state (see paper)
47% identity, 97% coverage: 2:753/772 of query aligns to 1:744/753 of 6zngF
6zn4A Maeb malic enzyme domain apoprotein (see paper)
59% identity, 52% coverage: 4:407/772 of query aligns to 2:405/406 of 6zn4A
6zn7A Maeb malic enzyme domain apoprotein (see paper)
59% identity, 52% coverage: 4:407/772 of query aligns to 2:405/405 of 6zn7A
2a9fA Crystal structure of a putative malic enzyme ((s)-malate:nad+ oxidoreductase (decarboxylating))
51% identity, 43% coverage: 19:353/772 of query aligns to 18:350/383 of 2a9fA
5ceeA Malic enzyme from candidatus phytoplasma aywb in complex with NAD and mg2+ (see paper)
46% identity, 48% coverage: 31:404/772 of query aligns to 26:385/387 of 5ceeA
2dvmA NAD complex structure of ph1275 protein from pyrococcus horikoshii
43% identity, 51% coverage: 9:405/772 of query aligns to 5:397/438 of 2dvmA
2haeD Crystal structure of a putative malic enzyme (malate oxidoreductase)
45% identity, 51% coverage: 9:399/772 of query aligns to 2:373/373 of 2haeD
2haeB Crystal structure of a putative malic enzyme (malate oxidoreductase)
45% identity, 51% coverage: 9:399/772 of query aligns to 2:373/373 of 2haeB
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
33% identity, 41% coverage: 429:747/772 of query aligns to 7:329/339 of 6ioxA
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 41% coverage: 437:752/772 of query aligns to 399:709/714 of Q8ZND6
Sites not aligning to the query:
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
28% identity, 40% coverage: 443:752/772 of query aligns to 20:324/325 of 1xcoD
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
27% identity, 42% coverage: 430:752/772 of query aligns to 5:328/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
27% identity, 42% coverage: 430:752/772 of query aligns to 4:327/332 of 2af3C
P16243 NADP-dependent malic enzyme, chloroplastic; NADP-ME; EC 1.1.1.40 from Zea mays (Maize) (see 3 papers)
27% identity, 44% coverage: 67:407/772 of query aligns to 229:612/636 of P16243
Sites not aligning to the query:
6c7nB Monoclinic form of malic enzyme from sorghum at 2 angstroms resolution (see paper)
28% identity, 36% coverage: 67:342/772 of query aligns to 146:477/553 of 6c7nB
Sites not aligning to the query:
6c7nA Monoclinic form of malic enzyme from sorghum at 2 angstroms resolution (see paper)
28% identity, 36% coverage: 67:342/772 of query aligns to 146:477/553 of 6c7nA
Sites not aligning to the query:
6w29A Trypanosoma cruzi malic enzyme in complex with inhibitor (mec013) (see paper)
25% identity, 37% coverage: 67:354/772 of query aligns to 133:481/545 of 6w29A
Sites not aligning to the query:
6w59A Trypanosoma cruzi malic enzyme in complex with inhibitor (mec063) (see paper)
25% identity, 37% coverage: 67:354/772 of query aligns to 131:479/544 of 6w59A
Sites not aligning to the query:
6w56A Trypanosoma cruzi malic enzyme in complex with inhibitor (mec062) (see paper)
25% identity, 37% coverage: 67:354/772 of query aligns to 131:479/544 of 6w56A
Sites not aligning to the query:
>AZOBR_RS21145 FitnessBrowser__azobra:AZOBR_RS21145
MSGDFDAMALEYHRNPKPGKLAIVATKPMANQRDLALAYSPGVAAASSAIAADPAQAAEL
TARANLVAVITNGTAVLGLGDIGPMAAKPVMEGKAVLFKKFAGIDCFDLELNEKDVDGLV
DTIVRLEPTFGAINLEDIAAPACFEVERRCRERMKIPVFHDDQHGTAIVVGAAVLNGLKL
VGKDISTVKVVSTGGGAAGIACLDLMLSLGVKRENVWLVDRIGVVHKGRNEEMNPYKDAY
AQETDARVLNDVIDGADIFLGLSGAKVLKPEMLVRMADKPLVLALANPEPEIMPDVARQA
RPDAIIATGRSDFPNQVNNVLCFPFIFRGALDVGATTVNEEMKIAATHAMASLAQAEPSD
VVAAAYVGENLRFGPDYILPKPFDPRLVIEVSSAVAKAAMESGVATRPIVDFRAYRDSLG
QYVFRSGLVMKPVITKAKAAPKRIVYAEGEEPRVLRCAQVVVDDGIAHPVLLGRADVIER
TIADMGLRIRIGKDVEVIEAARDLRCHNYAEVYRQLMGRRGVSPANALNVVRTQPSVFGA
LMVRRGEADGMVCGTSGRYGDHFNHVMDVIGLRKGVKVAGAMNGLISQKGTHFICDTYVN
PDPTAEQVAEIARLAAEEVKRFGIEPKVALLSHSNFGSADTPSARKMRLAYQLIAEENPD
LEVDGEMHADAALSEVLRKGVLPDSRLKGEANLLVMPTLDAANIAFNMLKIMADAQNVGP
MLLGAARPVHIVTPSVTTRGLVNMTAVAVVDAQLAAPVNAAPRPPALQDGED
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory