Comparing AZOBR_RS21760 FitnessBrowser__azobra:AZOBR_RS21760 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P23847 Dipeptide-binding protein; DBP; Periplasmic dipeptide transport protein from Escherichia coli (strain K12) (see 4 papers)
61% identity, 100% coverage: 2:532/533 of query aligns to 7:535/535 of P23847
Sites not aligning to the query:
1dppA Dipeptide binding protein complex with glycyl-l-leucine (see paper)
62% identity, 95% coverage: 26:532/533 of query aligns to 1:507/507 of 1dppA
5f1qA Crystal structure of periplasmic dipeptide transport protein from yersinia pestis
61% identity, 95% coverage: 26:531/533 of query aligns to 1:506/513 of 5f1qA
3m8uA Crystal structure of glutathione-binding protein a (gbpa) from haemophilus parasuis sh0165 in complex with glutathione disulfide (gssg) (see paper)
55% identity, 95% coverage: 26:531/533 of query aligns to 2:506/508 of 3m8uA
4qfpA Crystal structure of dipeptide binding protein from pseudoalteromonas sp. Sm9913 in complex with val-thr (see paper)
41% identity, 93% coverage: 28:522/533 of query aligns to 3:497/507 of 4qfpA
4qfoA Crystal structure of dipeptide binding protein from pseudoalteromonas sp. Sm9913 in complex with met-leu (see paper)
41% identity, 93% coverage: 28:522/533 of query aligns to 3:497/507 of 4qfoA
4qfnA Crystal structure of dipeptide binding protein from pseudoalteromonas sp. Sm9913 in complex with gly-glu (see paper)
41% identity, 93% coverage: 28:522/533 of query aligns to 3:497/507 of 4qfnA
4qflA Crystal structure of dipeptide binding protein from pseudoalteromonas sp. Sm9913 in complex with ala-phe (see paper)
41% identity, 93% coverage: 28:522/533 of query aligns to 3:497/507 of 4qflA
6ofqA Abc transporter-associated periplasmic binding protein dppa from helicobacter pylori in complex with peptide stsa (see paper)
39% identity, 95% coverage: 27:533/533 of query aligns to 11:512/512 of 6ofqA
7og0B Nontypeable haemophillus influenzae sapa in open and closed conformations, in complex with double stranded RNA (see paper)
31% identity, 93% coverage: 28:522/533 of query aligns to 3:488/498 of 7og0B
7ofwA Nontypeable haemophillus influenzae sapa in complex with heme (see paper)
30% identity, 93% coverage: 28:522/533 of query aligns to 2:483/493 of 7ofwA
1uqwA Crystal structure of ylib protein from escherichia coi
33% identity, 86% coverage: 74:532/533 of query aligns to 50:487/487 of 1uqwA
8upiA Structure of a periplasmic peptide binding protein from mesorhizobium sp. Ap09 bound to aminoserine
34% identity, 83% coverage: 56:500/533 of query aligns to 33:474/510 of 8upiA
Sites not aligning to the query:
6hlxA Structure of the pbp agaa in complex with agropinic acid from a.Tumefacien r10 (see paper)
30% identity, 86% coverage: 27:485/533 of query aligns to 2:433/491 of 6hlxA
Sites not aligning to the query:
1xocA The structure of the oligopeptide-binding protein, appa, from bacillus subtilis in complex with a nonapeptide. (see paper)
28% identity, 93% coverage: 23:520/533 of query aligns to 3:490/504 of 1xocA
Sites not aligning to the query:
4oevA Crystal structure of nikz from campylobacter jejuni in complex with ni(ii) ion (see paper)
27% identity, 93% coverage: 27:524/533 of query aligns to 6:481/494 of 4oevA
4oeuA Crystal structure of nikz from campylobacter jejuni in complex with ni(l-his) (see paper)
27% identity, 93% coverage: 27:524/533 of query aligns to 5:480/493 of 4oeuA
P24141 Oligopeptide-binding protein OppA; Stage 0 sporulation protein KA from Bacillus subtilis (strain 168) (see paper)
26% identity, 92% coverage: 4:496/533 of query aligns to 17:509/545 of P24141
8arnA Crystal structure of the peptide binding protein, oppa, from bacillus subtilis in complex with an endogenous tetrapeptide (see paper)
28% identity, 80% coverage: 73:496/533 of query aligns to 50:473/509 of 8arnA
Sites not aligning to the query:
4gl8A X-ray crystal structure of a periplasmic oligopeptide-binding protein/oligopeptide abc transporter(oppaiv) from borrelia burgdorferi
25% identity, 82% coverage: 66:503/533 of query aligns to 44:472/500 of 4gl8A
Sites not aligning to the query:
>AZOBR_RS21760 FitnessBrowser__azobra:AZOBR_RS21760
MKRILLGAGLGVAATLALAAPAQAAKTLVYCSEGSPENFNPMVNTTGTSFDVSLPVYNNL
VQFEYGGTKVVPGLAEKWEVSEDGLTYTFHLRKGVKWHSNNDFKPTRDANADDVLWSFNR
QWKKDHPFHKVSGGAYDYFNDMAMPDLLKSIEKVDDYTVKFTLNKVEAPFIANLAMPFAP
IQSAEYAEALQKKNQIDKIDQAPIGTGPFQFVAYQKDAVIRYKAFEPYWGGKAQLDNLVF
AITPDAAVRYAKLKAGECHIVPYPNPADLEAMKKDSAITLMEQEGLNVGYLAFNVTKKPF
DDVRVRRALNMAIDKKAVVDAVYQGAGVPAKNPIPPTMWSYNKEIEDYPYDPERAKKLLA
EAGFPDGFETDLWAMPVQRPYNPNAKRMAEMMQADLAKVGIKAKVVQYEWGEYRKRLQAG
EHQMGMLGWTGDNGDPDNFLHVLLGCEAARAGGSNIAKWCYKEFDDLVVQAKRTTDIAAR
TKLYEQAQVIFKEEAPWLTVAHSVVHMALSKNVVDYKMDPFGIHRFYGVDLKQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory