Comparing AZOBR_RS22280 FitnessBrowser__azobra:AZOBR_RS22280 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P35914 Hydroxymethylglutaryl-CoA lyase, mitochondrial; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Homo sapiens (Human) (see 11 papers)
63% identity, 98% coverage: 3:295/299 of query aligns to 29:321/325 of P35914
Sites not aligning to the query:
3mp3B Crystal structure of human lyase in complex with inhibitor hg-coa (see paper)
63% identity, 98% coverage: 3:295/299 of query aligns to 2:294/296 of 3mp3B
2cw6A Crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria (see paper)
63% identity, 98% coverage: 3:295/299 of query aligns to 2:294/296 of 2cw6A
3mp5B Crystal structure of human lyase r41m in complex with hmg-coa (see paper)
63% identity, 98% coverage: 3:295/299 of query aligns to 2:294/296 of 3mp5B
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
61% identity, 98% coverage: 3:295/299 of query aligns to 74:366/370 of Q8TB92
Sites not aligning to the query:
1ydnA Crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35. (see paper)
58% identity, 92% coverage: 5:279/299 of query aligns to 2:276/283 of 1ydnA
P13703 Hydroxymethylglutaryl-CoA lyase; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Pseudomonas mevalonii (see paper)
56% identity, 96% coverage: 5:291/299 of query aligns to 2:288/301 of P13703
6ndsA Structure of an hmg-coa lyase from acenitobacter baumannii in complex with coenzyme a and 3-methylmalate
39% identity, 95% coverage: 11:295/299 of query aligns to 12:295/305 of 6ndsA
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
26% identity, 75% coverage: 15:238/299 of query aligns to 30:247/399 of 6ktqA
2nx9B Crystal structure of the carboxyltransferase domain of the oxaloacetate decarboxylase na+ pump from vibrio cholerae (see paper)
32% identity, 41% coverage: 161:282/299 of query aligns to 161:275/453 of 2nx9B
Sites not aligning to the query:
Q70AC7 Methylmalonyl-CoA carboxyltransferase 5S subunit; Transcarboxylase 5S subunit; EC 2.1.3.1 from Propionibacterium freudenreichii subsp. shermanii (see paper)
30% identity, 40% coverage: 154:273/299 of query aligns to 157:275/505 of Q70AC7
Sites not aligning to the query:
1rqhA Propionibacterium shermanii transcarboxylase 5s subunit bound to pyruvic acid (see paper)
30% identity, 40% coverage: 154:273/299 of query aligns to 154:272/471 of 1rqhA
Sites not aligning to the query:
1rr2A Propionibacterium shermanii transcarboxylase 5s subunit bound to 2- ketobutyric acid (see paper)
30% identity, 40% coverage: 154:273/299 of query aligns to 155:273/472 of 1rr2A
Sites not aligning to the query:
1rqeA Propionibacterium shermanii transcarboxylase 5s subunit bound to oxaloacetate (see paper)
30% identity, 40% coverage: 154:273/299 of query aligns to 155:273/472 of 1rqeA
Sites not aligning to the query:
1rqbA Propionibacterium shermanii transcarboxylase 5s subunit (see paper)
30% identity, 40% coverage: 154:273/299 of query aligns to 155:273/472 of 1rqbA
Sites not aligning to the query:
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
28% identity, 43% coverage: 159:287/299 of query aligns to 150:279/308 of 3rmjB
Sites not aligning to the query:
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
28% identity, 43% coverage: 159:287/299 of query aligns to 153:282/517 of Q9JZG1
Sites not aligning to the query:
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 65% coverage: 93:285/299 of query aligns to 180:370/506 of Q9FG67
Sites not aligning to the query:
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 65% coverage: 93:285/299 of query aligns to 180:370/503 of Q9FN52
P11154 Pyruvate carboxylase 1; Pyruvic carboxylase 1; PCB 1; EC 6.4.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 41% coverage: 161:282/299 of query aligns to 718:832/1178 of P11154
Sites not aligning to the query:
>AZOBR_RS22280 FitnessBrowser__azobra:AZOBR_RS22280
MRLPKSVRMVEVGPRDGLQNEKQIVPTAVKIGLVDRLTDAGLTAIEAGSFVSPKWVPQMA
DTPDVFAGIRRKEGVRYVALTPNAKGLEGALAARADEVAVFAAASESFSQKNINCSIAES
LDRFVPVLEQAKAQGVPVRGYVSCVLGCPYEGEIAPAAVAEVAGRLLAMGCYEVSLGDTI
GTGTPSKAQAMIAAVAKRVPMERLAVHFHDTYGQALANILATLEMGVAVVDSSVAGLGGC
PYAKGASGNVASEDVLYMLNGLGVATGVDLDRLVAAGAYISDAIGRPTASKVARARGCA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory