SitesBLAST
Comparing AZOBR_RS22505 FitnessBrowser__azobra:AZOBR_RS22505 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4uhmA Characterization of a novel transaminase from pseudomonas sp. Strain aac (see paper)
68% identity, 99% coverage: 5:436/436 of query aligns to 3:435/435 of 4uhmA
- active site: F11 (= F13), Y140 (= Y142), E213 (= E214), D246 (= D247), I249 (= I250), K275 (= K276), Q408 (= Q409)
- binding magnesium ion: A91 (= A93), D99 (= D101)
- binding pyridoxal-5'-phosphate: G107 (= G109), S108 (= S110), Y140 (= Y142), H141 (= H143), G142 (= G144), E213 (= E214), D246 (= D247), V248 (= V249), I249 (= I250), K275 (= K276)
Q9I700 Beta-alanine--pyruvate aminotransferase; Beta-A--Py AT; Beta-alanine--pyruvate transaminase; Omega-amino acid aminotransferase; Omega-amino acid AT; Omega-amino acid--pyruvate aminotransferase; Omega-APT; EC 2.6.1.18 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
67% identity, 99% coverage: 5:436/436 of query aligns to 16:448/448 of Q9I700
- W61 (= W50) binding
- T327 (= T315) binding
- R414 (= R402) binding
- Q421 (= Q409) binding
4b98A The structure of the omega aminotransferase from pseudomonas aeruginosa (see paper)
67% identity, 99% coverage: 5:436/436 of query aligns to 9:441/441 of 4b98A
- active site: F17 (= F13), Y146 (= Y142), E219 (= E214), D252 (= D247), I255 (= I250), K281 (= K276), Q414 (= Q409)
- binding pyridoxal-5'-phosphate: G233 (= G228), Q236 (= Q231), F270 (= F265), G271 (= G266)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: L53 (= L49), W54 (= W50), F82 (= F78), S112 (= S108), G113 (= G109), S114 (= S110), Y146 (= Y142), H147 (= H143), G148 (= G144), E219 (= E214), S224 (= S219), D252 (= D247), V254 (= V249), I255 (= I250), K281 (= K276), Y319 (= Y314), T320 (= T315), R407 (= R402), Q414 (= Q409)
3a8uX Crystal structure of omega-amino acid:pyruvate aminotransferase
65% identity, 99% coverage: 2:433/436 of query aligns to 5:438/441 of 3a8uX
- active site: Y145 (= Y142), D252 (= D247), K281 (= K276), Q414 (= Q409)
- binding pyridoxal-5'-phosphate: S111 (= S108), G112 (= G109), S113 (= S110), Y145 (= Y142), H146 (= H143), G147 (= G144), E219 (= E214), D252 (= D247), V254 (= V249), I255 (= I250), K281 (= K276)
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
56% identity, 97% coverage: 4:428/436 of query aligns to 7:431/439 of Q9A3Q9
- V227 (= V222) mutation to G: Decreases activity toward 3-aminobutanoate by 2-fold. Increases activity toward the aromatic beta-amino acid 3-amino-3-phenylpropanoate by 2-fold.
- R260 (= R255) mutation to L: Decreases activity toward 3-aminobutanoate by 30-fold.
- N285 (= N280) mutation to A: Decreases activity toward 3-aminobutanoate by 4-fold. Increases activity toward the aromatic beta-amino acid 3-amino-3-phenylpropanoate by 3-fold.
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
37% identity, 98% coverage: 9:436/436 of query aligns to 14:446/450 of 6gwiB
- active site: F18 (= F13), Y149 (= Y142), D255 (= D247), K284 (= K276)
- binding pyridoxal-5'-phosphate: S115 (= S108), G116 (= G109), S117 (= S110), Y149 (= Y142), H150 (= H143), G151 (= G144), E222 (= E214), D255 (= D247), V257 (= V249), I258 (= I250), K284 (= K276)
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
36% identity, 94% coverage: 24:435/436 of query aligns to 2:417/422 of 7qx3A
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
36% identity, 99% coverage: 1:433/436 of query aligns to 8:444/448 of 6io1B
- active site: L20 (≠ F13), Y151 (= Y142), D257 (= D247), K286 (= K276)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (≠ S108), G118 (= G109), A119 (≠ S110), N122 (≠ T113), Y151 (= Y142), H152 (= H143), D257 (= D247), V259 (= V249), I260 (= I250), K286 (= K276)
6s54A Transaminase from pseudomonas fluorescens (see paper)
39% identity, 95% coverage: 23:435/436 of query aligns to 31:451/453 of 6s54A
- active site: Y152 (= Y142), D258 (= D247), K287 (= K276)
- binding pyridoxal-5'-phosphate: G119 (= G109), S120 (= S110), Y152 (= Y142), H153 (= H143), G154 (= G144), E225 (= E214), D258 (= D247), V260 (= V249), I261 (= I250), K287 (= K276)
Sites not aligning to the query:
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
34% identity, 99% coverage: 4:435/436 of query aligns to 6:438/443 of 7qx0B
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
36% identity, 99% coverage: 1:432/436 of query aligns to 6:444/454 of 7ypmA
- binding alanine: W57 (= W50), Y150 (= Y142)
- binding pyridoxal-5'-phosphate: S116 (= S108), G117 (= G109), S118 (= S110), Y150 (= Y142), G152 (= G144), E223 (= E214), D256 (= D247), V258 (= V249), I259 (= I250), K285 (= K276)
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
38% identity, 93% coverage: 25:431/436 of query aligns to 27:442/447 of 5lhaA
- active site: Y146 (= Y142), D253 (= D247), K282 (= K276), T319 (= T315)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G113 (= G109), S114 (= S110), Y146 (= Y142), H147 (= H143), G148 (= G144), E220 (= E214), D253 (= D247), K282 (= K276), Y318 (= Y314), T319 (= T315)
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
38% identity, 93% coverage: 25:431/436 of query aligns to 29:444/449 of 5lh9D
- active site: Y148 (= Y142), D255 (= D247), K284 (= K276), T321 (= T315)
- binding pyridoxal-5'-phosphate: G115 (= G109), S116 (= S110), Y148 (= Y142), H149 (= H143), G150 (= G144), E222 (= E214), D255 (= D247), V257 (= V249), K284 (= K276)
7q9xAAA Probable aminotransferase
35% identity, 98% coverage: 5:433/436 of query aligns to 8:443/455 of 7q9xAAA
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: L55 (= L49), W56 (= W50), S115 (= S108), G116 (= G109), S117 (= S110), Y149 (= Y142), G151 (= G144), E222 (= E214), D255 (= D247), V257 (= V249), I258 (= I250), K284 (= K276), F316 (≠ Y314), T317 (= T315), R412 (= R402)
- binding pyridoxal-5'-phosphate: F316 (≠ Y314), T317 (= T315)
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
35% identity, 98% coverage: 5:433/436 of query aligns to 8:443/455 of 4a6tC
- active site: F18 (= F13), Y149 (= Y142), E222 (= E214), D255 (= D247), I258 (= I250), K284 (= K276), V419 (≠ Q409)
- binding pyridoxal-5'-phosphate: G116 (= G109), S117 (= S110), Y149 (= Y142), H150 (= H143), G151 (= G144), E222 (= E214), D255 (= D247), V257 (= V249), I258 (= I250), K284 (= K276)
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
35% identity, 98% coverage: 5:433/436 of query aligns to 7:442/453 of 6s4gA
- active site: F17 (= F13), Y148 (= Y142), D254 (= D247), K283 (= K276)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S114 (= S108), G115 (= G109), S116 (= S110), Y148 (= Y142), H149 (= H143), G150 (= G144), E221 (= E214), D254 (= D247), V256 (= V249), I257 (= I250), K283 (= K276), F315 (≠ Y314), T316 (= T315)
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
35% identity, 95% coverage: 20:432/436 of query aligns to 22:434/444 of 3i5tA
- active site: Y144 (= Y142), E216 (= E214), D249 (= D247), V252 (≠ I250), K279 (= K276), V411 (≠ Q409)
- binding pyridoxal-5'-phosphate: G111 (= G109), S112 (= S110), Y144 (= Y142), H145 (= H143), E216 (= E214), D249 (= D247), V251 (= V249), K279 (= K276), Y315 (= Y314), T316 (= T315)
Sites not aligning to the query:
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
35% identity, 94% coverage: 24:433/436 of query aligns to 1:411/423 of 4a6rA
- active site: Y120 (= Y142), E190 (= E214), D223 (= D247), I226 (= I250), K252 (= K276), V387 (≠ Q409)
- binding polyacrylic acid: T84 (≠ V106), N85 (= N107), S86 (= S108), S88 (= S110), E89 (= E111), T93 (= T115), R96 (≠ K118), Y120 (= Y142), S123 (≠ V145), T124 (≠ N146)
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
36% identity, 99% coverage: 1:432/436 of query aligns to 6:444/455 of 7ypnD
- binding pyridoxal-5'-phosphate: S116 (= S108), G117 (= G109), S118 (= S110), Y150 (= Y142), H151 (= H143), G152 (= G144), E223 (= E214), D256 (= D247), V258 (= V249), K285 (= K276), F318 (≠ Y314), T319 (= T315)
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
34% identity, 98% coverage: 5:432/436 of query aligns to 5:435/443 of 6fyqA
- active site: F15 (= F13), Y147 (= Y142), D243 (= D247), K272 (= K276)
- binding pyridoxal-5'-phosphate: G114 (= G109), S115 (= S110), Y147 (= Y142), H148 (= H143), G149 (= G144), E210 (= E214), D243 (= D247), V245 (= V249), I246 (= I250), K272 (= K276)
Query Sequence
>AZOBR_RS22505 FitnessBrowser__azobra:AZOBR_RS22505
LTREELDAHWMPFTANREFKANPRLIARAEGAWYWDAEGRKIYDSLSGLWCCGAGHSRRE
ISEAVARQIAELDYSPAFQFGHPAAFKLAHKLASMTPAGLDHVFFVNSGSEATDTSLKMA
RAYWRLKGQPAKTKLIGRSKGYHGVNFGGISLGGIGGNRKLFGSGVEADHLPHTLLPQNA
FTKGLPEQGAELADALEELVALHDASNIAAVIVEPLAGSAGVLPPPKGYLQRLRALCDKH
NILLIFDEVITGFGRMGAAFGADAFGVVPDIMNVAKGLTNGAVPMGAVVANHEIYQTFMD
NGGADYMVEFPHGYTYSAHPVACAAGLAALELFERDKLAEKAADLAPHFETVLHGLKGLR
HVTDIRNYGLAGAVQIAALPGEPARRPYEIAMKCWKAGFYVRFGGDTLQFGPHFISERED
LDRLMNAVSDAIQATA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory