SitesBLAST
Comparing AZOBR_RS22705 FitnessBrowser__azobra:AZOBR_RS22705 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3afnB Crystal structure of aldose reductase a1-r complexed with NADP (see paper)
70% identity, 99% coverage: 2:256/258 of query aligns to 1:255/257 of 3afnB
- active site: G17 (= G18), S149 (= S150), I150 (≠ V151), A160 (= A161), Y163 (= Y164), K167 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), Q16 (= Q17), G17 (= G18), H36 (≠ N37), R38 (= R39), D64 (= D65), L65 (≠ V66), N91 (= N92), A92 (= A93), G93 (= G94), T147 (≠ V148), S149 (= S150), Y163 (= Y164), K167 (= K168), P193 (= P194), G194 (= G195), T195 (= T196), V196 (≠ F197), T198 (= T199), F200 (= F201), H201 (= H202)
4tkmB Crystal structure of nadh-dependent reductase a1-r' complexed with nad (see paper)
57% identity, 100% coverage: 1:258/258 of query aligns to 1:241/241 of 4tkmB
- active site: G18 (= G18), S150 (= S150), Y164 (= Y164), K168 (= K168)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), T16 (= T16), E17 (≠ Q17), I19 (= I19), S38 (≠ G38), H39 (≠ R39), I66 (≠ V66), N92 (= N92), G94 (= G94), T148 (≠ V148), S150 (= S150), Y164 (= Y164), K168 (= K168), G195 (= G195), T196 (= T196)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 98% coverage: 5:257/258 of query aligns to 5:244/244 of 4nbuB
- active site: G18 (= G18), N111 (= N117), S139 (= S150), Q149 (≠ A161), Y152 (= Y164), K156 (= K168)
- binding acetoacetyl-coenzyme a: D93 (≠ R99), K98 (≠ E104), S139 (= S150), N146 (≠ G158), V147 (≠ P159), Q149 (≠ A161), Y152 (= Y164), F184 (≠ T196), M189 (≠ F201), K200 (≠ R212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ Q17), G18 (= G18), I19 (= I19), D38 (≠ G38), F39 (≠ R39), V59 (≠ A64), D60 (= D65), V61 (= V66), N87 (= N92), A88 (= A93), G89 (= G94), I90 (≠ L96), T137 (≠ V148), S139 (= S150), Y152 (= Y164), K156 (= K168), P182 (= P194), F184 (≠ T196), T185 (≠ F197), T187 (= T199), M189 (≠ F201)
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
36% identity, 100% coverage: 1:258/258 of query aligns to 5:254/262 of 3pk0B
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
35% identity, 98% coverage: 1:254/258 of query aligns to 1:251/255 of 5itvA
- active site: G18 (= G18), S141 (= S150), Y154 (= Y164), K158 (= K168)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ Q17), G18 (= G18), I19 (= I19), D38 (= D44), I39 (≠ L45), T61 (≠ A64), I63 (≠ V66), N89 (= N92), G91 (= G94), T139 (≠ V148), S141 (= S150), Y154 (= Y164), K158 (= K168), P184 (= P194), G185 (= G195), I186 (≠ T196), I187 (≠ F197)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
36% identity, 98% coverage: 5:257/258 of query aligns to 3:243/244 of 7krmC
- active site: G18 (= G18), S140 (= S150), Y155 (= Y164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (= S15), G18 (= G18), I19 (= I19), D38 (≠ P42), L39 (≠ A43), A60 (= A64), N61 (≠ D65), V62 (= V66), N88 (= N92), V111 (≠ L116), S140 (= S150), Y155 (= Y164), K159 (= K168), I188 (≠ F197), T190 (= T199)
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
33% identity, 98% coverage: 3:254/258 of query aligns to 42:285/290 of 3ijrF
- active site: G57 (= G18), S182 (= S150), L192 (≠ G160), Y195 (= Y164), K199 (= K168), K240 (≠ D208)
- binding magnesium ion: D55 (≠ T16), S56 (≠ Q17), E80 (≠ I41)
- binding nicotinamide-adenine-dinucleotide: D55 (≠ T16), S56 (≠ Q17), G57 (= G18), I58 (= I19), Y77 (≠ G38), L78 (≠ R39), E80 (≠ I41), G103 (≠ A64), D104 (= D65), L105 (≠ V66), N131 (= N92), V132 (≠ A93), A133 (≠ G94), Q134 (≠ G95), I155 (≠ L116), T180 (≠ V148), S182 (= S150), Y195 (= Y164), K199 (= K168), P225 (= P194), G226 (= G195), P227 (≠ T196), I228 (≠ F197), T230 (= T199), L232 (≠ F201)
Sites not aligning to the query:
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
33% identity, 98% coverage: 3:254/258 of query aligns to 34:277/282 of 3i3oA
- active site: G49 (= G18), S174 (= S150), L184 (≠ G160), Y187 (= Y164), K191 (= K168), K232 (≠ D208)
- binding magnesium ion: D47 (≠ T16), S48 (≠ Q17), E72 (≠ I41)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G14), D47 (≠ T16), S48 (≠ Q17), G49 (= G18), I50 (= I19), Y69 (≠ G38), L70 (≠ R39), E72 (≠ I41), G95 (≠ A64), D96 (= D65), L97 (≠ V66), N123 (= N92), V124 (≠ A93), A125 (≠ G94), Q126 (≠ G95), Q127 (≠ L96), I147 (≠ L116), T172 (≠ V148), S174 (= S150), Y187 (= Y164), K191 (= K168), P217 (= P194), G218 (= G195), I220 (≠ F197), T222 (= T199), L224 (≠ F201)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
35% identity, 98% coverage: 1:254/258 of query aligns to 1:223/227 of 5itvD
- active site: G18 (= G18), S141 (= S150), Y154 (= Y164), K158 (= K168)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ Q17), G18 (= G18), I19 (= I19), D38 (= D44), I39 (≠ L45), T61 (≠ A64), D62 (= D65), I63 (≠ V66), N89 (= N92), T139 (≠ V148), S141 (= S150), Y154 (= Y164), K158 (= K168), P184 (= P194), G185 (= G195), I187 (≠ F197)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
35% identity, 95% coverage: 10:255/258 of query aligns to 7:250/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ T16), R14 (≠ Q17), G15 (= G18), I16 (= I19), L36 (≠ R39), R37 (= R40), N38 (≠ I41), A61 (= A64), D62 (= D65), V63 (= V66), N89 (= N92), A90 (= A93), G91 (= G94), T113 (≠ L116), V143 (= V148), S145 (= S150), Y159 (= Y164), K163 (= K168), P189 (= P194), G190 (= G195), I192 (≠ F197), T194 (= T199), I196 (≠ F201), H197 (= H202)
3r3sA Structure of the ygha oxidoreductase from salmonella enterica
33% identity, 98% coverage: 5:257/258 of query aligns to 45:291/292 of 3r3sA
- active site: G58 (= G18), S184 (= S150), L194 (= L163), Y197 (= Y164), K201 (= K168), Q242 (≠ E207)
- binding magnesium ion: D56 (≠ T16), S57 (≠ Q17), E82 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: D56 (≠ T16), S57 (≠ Q17), G58 (= G18), I59 (= I19), L79 (≠ I41), E82 (vs. gap), D106 (= D65), L107 (≠ V66), V133 (≠ N92), A134 (= A93), G135 (= G94), S184 (= S150), Y197 (= Y164), K201 (= K168), P227 (= P194), G228 (= G195), I230 (≠ F197), T232 (= T199), L234 (≠ F201), Q235 (≠ H202)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
35% identity, 97% coverage: 5:254/258 of query aligns to 4:245/249 of 4bmsF
- active site: S137 (= S150), H147 (≠ A161), Y150 (= Y164), K154 (= K168), Q195 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ T16), S16 (≠ Q17), I18 (= I19), R38 (= R39), R39 (= R40), A59 (= A64), D60 (= D65), V61 (= V66), N87 (= N92), S88 (≠ A93), G89 (= G94), V110 (≠ L116), S137 (= S150), Y150 (= Y164), K154 (= K168), G181 (= G195), I183 (≠ F197), T185 (= T199), I187 (≠ F201)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
32% identity, 99% coverage: 1:256/258 of query aligns to 1:253/261 of 1g6kA
- active site: G18 (= G18), S145 (= S150), Y158 (= Y164), K162 (= K168)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ Q17), G18 (= G18), L19 (≠ I19), R39 (= R39), D65 (= D65), V66 (= V66), N92 (= N92), A93 (= A93), G94 (= G95), M143 (≠ V148), S145 (= S150), Y158 (= Y164), P188 (= P194), G189 (= G195), I191 (≠ F197), T193 (= T199)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
32% identity, 99% coverage: 1:256/258 of query aligns to 1:253/261 of P40288
- 11:35 (vs. 11:35, 44% identical) binding
- E96 (≠ R99) mutation E->A,G,K: Heat stable.
- D108 (≠ F109) mutation to N: Heat stable.
- V112 (= V113) mutation to A: Heat stable.
- E133 (≠ Q138) mutation to K: Heat stable.
- V183 (≠ F189) mutation to I: Heat stable.
- P194 (≠ A200) mutation to Q: Heat stable.
- E210 (≠ G214) mutation to K: Heat stable.
- Y217 (≠ R221) mutation to H: Heat stable.
- Q252 (= Q255) mutation to L: Heat stable.
- Y253 (= Y256) mutation to C: Heat stable.
Sites not aligning to the query:
- 258 A→G: Heat stable.
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
36% identity, 97% coverage: 5:254/258 of query aligns to 4:245/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S150), H147 (≠ A161), Y150 (= Y164), L188 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ T16), S16 (≠ Q17), G17 (= G18), I18 (= I19), R38 (= R39), R39 (= R40), D60 (= D65), V61 (= V66), N87 (= N92), S88 (≠ A93), G89 (= G94), V110 (≠ L116), T135 (≠ V148), S137 (= S150), Y150 (= Y164), K154 (= K168), P180 (= P194), G181 (= G195), A182 (≠ T196), I183 (≠ F197), T185 (= T199), S187 (vs. gap)
Sites not aligning to the query:
5jydB Crystal structure of a putative short chain dehydrogenase from burkholderia cenocepacia
34% identity, 97% coverage: 5:254/258 of query aligns to 45:288/292 of 5jydB
- active site: G58 (= G18), S184 (= S144), L194 (≠ Y154), Y197 (= Y164), K201 (= K168), P242 (≠ E207)
- binding magnesium ion: D56 (≠ T16), S57 (≠ Q17), E82 (≠ P42)
- binding nicotinamide-adenine-dinucleotide: G54 (= G14), D56 (≠ T16), S57 (≠ Q17), G58 (= G18), I59 (= I19), L79 (≠ R39), E82 (≠ P42), D106 (= D65), I107 (≠ V66), N133 (= N92), A134 (= A93), A135 (≠ G94), T182 (= T141), S184 (= S144), Y197 (= Y164), K201 (= K168), P227 (= P194), G228 (= G195), P229 (≠ T196), Y230 (≠ F197), T232 (= T199), L234 (≠ F201), Q235 (≠ H202)
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
32% identity, 100% coverage: 1:258/258 of query aligns to 3:252/259 of 6ci9D
- active site: G20 (= G18), S145 (≠ V145), Y159 (= Y164)
- binding 1-aminopropan-2-one: F97 (≠ V97), S145 (≠ V145), T147 (≠ S147), W156 (≠ A161), Y159 (= Y164), G190 (= G195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G14), S18 (≠ T16), G20 (= G18), I21 (= I19), G40 (= G38), R41 (= R39), N42 (≠ R40), D66 (= D65), V67 (= V66), N93 (= N92), G95 (= G95), T143 (≠ S143), S145 (≠ V145), Y159 (= Y164), K163 (= K168), P189 (= P194), N191 (≠ T196), I192 (≠ F197), T194 (= T199), G196 (≠ F201), L197 (≠ H202)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
33% identity, 98% coverage: 5:257/258 of query aligns to 4:246/247 of P73574
- A14 (≠ S15) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P159) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K168) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ T196) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ K210) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
31% identity, 98% coverage: 1:254/258 of query aligns to 7:255/267 of 3ay6B
- active site: G24 (= G18), S151 (= S150), Y164 (= Y164), K168 (= K168)
- binding beta-D-glucopyranose: E102 (≠ R99), S151 (= S150), H153 (≠ A152), W158 (≠ G158), Y164 (= Y164), N202 (≠ H202), K205 (= K205)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G14), T23 (≠ Q17), G24 (= G18), L25 (≠ I19), Y45 (≠ R39), D71 (= D65), V72 (= V66), N98 (= N92), A99 (= A93), G100 (= G94), V101 (≠ A98), M149 (≠ V148), S151 (= S150), Y164 (= Y164), K168 (= K168), P194 (= P194), G195 (= G195), M197 (≠ F197), T199 (= T199), P200 (≠ A200), I201 (≠ F201), N202 (≠ H202)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
30% identity, 97% coverage: 8:257/258 of query aligns to 5:246/246 of 3osuA
Query Sequence
>AZOBR_RS22705 FitnessBrowser__azobra:AZOBR_RS22705
MFDDLKGKRVLITGSTQGIGLAAVEAFARAGAKVAMNGRRIPADLEATLARLNGLGGEVV
FLQADVSDSAACGTLVEAFVERFGGIDVLINNAGGLVARKPLPEIDDAFFDAVTDLNSRS
ALMVTKHALPHLKAAASQNGTTSSVISVGSVAGYTGGGPGAGLYGAAKAWLHNIQKNWVA
FHTKDGIRFNMVSPGTFDTAFHADKDEDTKARIGSGFPMGRFGRPEECAPTFLFFASHTC
SGYITGQVLDVNGGQYMP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory