Comparing AZOBR_RS22730 FitnessBrowser__azobra:AZOBR_RS22730 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q6BF16 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; 2-oxo-3-deoxygalactonate 6-phosphate aldolase; 6-phospho-2-dehydro-3-deoxygalactonate aldolase; 6-phospho-2-keto-3-deoxygalactonate aldolase; KDPGal; EC 4.1.2.21 from Escherichia coli (strain K12) (see paper)
48% identity, 92% coverage: 15:212/216 of query aligns to 5:202/205 of Q6BF16
2v82A Kdpgal complexed to kdpgal (see paper)
48% identity, 92% coverage: 15:212/216 of query aligns to 4:201/205 of 2v82A
Sites not aligning to the query:
1wa3D Mechanism of the class i kdpg aldolase (see paper)
36% identity, 94% coverage: 9:211/216 of query aligns to 1:200/203 of 1wa3D
1euaA Schiff base intermediate in kdpg aldolase from escherichia coli (see paper)
34% identity, 66% coverage: 34:176/216 of query aligns to 32:173/213 of 1euaA
Sites not aligning to the query:
P0A955 KHG/KDPG aldolase; EC 4.1.3.16; EC 4.1.2.14 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 66% coverage: 34:176/216 of query aligns to 32:173/213 of P0A955
Sites not aligning to the query:
3vcrA Crystal structure of a putative kdpg (2-keto-3-deoxy-6- phosphogluconate) aldolase from oleispira antarctica (see paper)
33% identity, 66% coverage: 34:176/216 of query aligns to 29:176/216 of 3vcrA
2c0aB Mechanism of the class i kdpg aldolase (see paper)
33% identity, 66% coverage: 34:176/216 of query aligns to 33:174/214 of 2c0aB
Sites not aligning to the query:
1wauA Structure of kdpg aldolase e45n mutant (see paper)
33% identity, 66% coverage: 34:176/216 of query aligns to 32:173/213 of 1wauA
Sites not aligning to the query:
5xsfA Crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of zymomonas mobilis zm4 with 3-phosphoglycerate
30% identity, 78% coverage: 10:177/216 of query aligns to 5:170/209 of 5xsfA
Sites not aligning to the query:
P00885 2-dehydro-3-deoxy-phosphogluconate aldolase; KDPG-aldolase; Phospho-2-dehydro-3-deoxygluconate aldolase; Phospho-2-keto-3-deoxygluconate aldolase; EC 4.1.2.14 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
32% identity, 78% coverage: 8:176/216 of query aligns to 18:185/226 of P00885
Sites not aligning to the query:
1mxsA Crystal structure of 2-keto-3-deoxy-6-phosphogluconate (kdpg) aldolase from pseudomonas putida. (see paper)
32% identity, 78% coverage: 8:176/216 of query aligns to 8:175/216 of 1mxsA
Sites not aligning to the query:
6oviA Crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate
26% identity, 79% coverage: 7:176/216 of query aligns to 2:170/210 of 6oviA
>AZOBR_RS22730 FitnessBrowser__azobra:AZOBR_RS22730
MSDDSLKARFDAAFSALPLVAILRGLTPAEAEGVAQTLYDSGFRMIEVPLNSPDPFTSIA
AVRRLLPRDALVGAGTVLAVEQVARLKEIGADLVVMPHADTAVIRAAKAAGLVSLPGIAT
PTEAFAALSAGADALKIFPAELVGPRIIKAMRAILPAGTRLLPVGGIAPDTMAPFLEAGV
AGFGLGSALYAPGLSAAEVGVRADAFVAAWRRLNPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory