SitesBLAST
Comparing AZOBR_RS22955 FitnessBrowser__azobra:AZOBR_RS22955 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
29% identity, 52% coverage: 10:324/608 of query aligns to 6:324/335 of 5a05A
- active site: K100 (= K100), Y185 (≠ H187)
- binding beta-D-glucopyranose: K100 (= K100), F159 (= F159), D181 (= D183), Y185 (≠ H187)
- binding alpha-D-glucopyranose: P259 (≠ Q259), S262 (= S262)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G13), L10 (≠ C14), G11 (= G15), Y12 (≠ S16), Y13 (≠ I17), S35 (≠ D38), G36 (≠ P39), T37 (= T40), K40 (≠ R43), Y58 (≠ V58), I76 (≠ A76), T77 (≠ A77), P78 (= P78), N79 (≠ P79), L81 (= L81), H82 (= H82), E99 (= E99), K100 (= K100), R128 (≠ M128), W167 (vs. gap), R168 (vs. gap), Y185 (≠ H187), Y263 (≠ D263)
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
29% identity, 52% coverage: 10:324/608 of query aligns to 6:324/335 of 5a04A
- active site: K100 (= K100), Y185 (≠ H187)
- binding beta-D-glucopyranose: K100 (= K100), F159 (= F159), R168 (vs. gap), D181 (= D183), Y185 (≠ H187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ C14), G11 (= G15), Y12 (≠ S16), Y13 (≠ I17), S35 (≠ D38), G36 (≠ P39), T37 (= T40), K40 (≠ R43), Y58 (≠ V58), I76 (≠ A76), T77 (≠ A77), P78 (= P78), N79 (≠ P79), L81 (= L81), H82 (= H82), E99 (= E99), K100 (= K100), R128 (≠ M128), W167 (vs. gap), R168 (vs. gap), Y185 (≠ H187), Y263 (≠ D263)
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
29% identity, 52% coverage: 10:324/608 of query aligns to 6:324/335 of 5a03E
- active site: K100 (= K100), Y185 (≠ H187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G13), L10 (≠ C14), G11 (= G15), Y12 (≠ S16), Y13 (≠ I17), S35 (≠ D38), G36 (≠ P39), T37 (= T40), K40 (≠ R43), Y58 (≠ V58), I76 (≠ A76), T77 (≠ A77), P78 (= P78), N79 (≠ P79), H82 (= H82), E99 (= E99), K100 (= K100), R128 (≠ M128), W167 (vs. gap), R168 (vs. gap), Y185 (≠ H187), Y263 (≠ D263)
- binding beta-D-xylopyranose: K100 (= K100), F159 (= F159), R168 (vs. gap), D181 (= D183), Y185 (≠ H187), E205 (≠ A200), T207 (≠ V202), R209 (≠ Y204)
- binding alpha-D-xylopyranose: H134 (≠ N133), M268 (≠ L268), R279 (≠ H279), E280 (≠ I280)
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
29% identity, 52% coverage: 10:324/608 of query aligns to 6:324/335 of 5a02A
- active site: K100 (= K100), Y185 (≠ H187)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (≠ C14), G11 (= G15), Y12 (≠ S16), Y13 (≠ I17), S35 (≠ D38), G36 (≠ P39), T37 (= T40), K40 (≠ R43), Y58 (≠ V58), I76 (≠ A76), T77 (≠ A77), P78 (= P78), L81 (= L81), H82 (= H82), E99 (= E99), K100 (= K100), R128 (≠ M128), W167 (vs. gap), R168 (vs. gap), Y185 (≠ H187), Y263 (≠ D263)
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
29% identity, 52% coverage: 10:324/608 of query aligns to 7:325/336 of 5a06A
- active site: K101 (= K100), Y186 (≠ H187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (≠ C14), G12 (= G15), Y13 (≠ S16), Y14 (≠ I17), S36 (≠ D38), G37 (≠ P39), T38 (= T40), K41 (≠ R43), Y59 (≠ V58), I77 (≠ A76), T78 (≠ A77), P79 (= P78), N80 (≠ P79), L82 (= L81), H83 (= H82), E100 (= E99), K101 (= K100), R129 (≠ M128), W168 (vs. gap), R169 (vs. gap), Y186 (≠ H187), Y264 (≠ D263)
- binding sorbitol: D72 (= D71), H96 (= H95), K101 (= K100), R122 (= R121), R122 (= R121), L124 (= L123), F160 (= F159), R169 (vs. gap), D182 (= D183), Y186 (≠ H187), K287 (≠ G286), H296 (≠ D295), E299 (≠ D298), E306 (≠ P305), G310 (= G309), G311 (= G310)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
29% identity, 52% coverage: 10:324/608 of query aligns to 7:325/336 of 5a03C
- active site: K101 (= K100), Y186 (≠ H187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G13), L11 (≠ C14), G12 (= G15), Y13 (≠ S16), Y14 (≠ I17), S36 (≠ D38), G37 (≠ P39), T38 (= T40), K41 (≠ R43), Y59 (≠ V58), I77 (≠ A76), T78 (≠ A77), P79 (= P78), N80 (≠ P79), L82 (= L81), H83 (= H82), E100 (= E99), K101 (= K100), R129 (≠ M128), W168 (vs. gap), R169 (vs. gap), Y186 (≠ H187), Y264 (≠ D263)
- binding beta-D-xylopyranose: K101 (= K100), F160 (= F159), R169 (vs. gap), D182 (= D183), Y186 (≠ H187)
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
27% identity, 53% coverage: 10:334/608 of query aligns to 35:373/381 of 1rydA
- active site: K129 (= K100), Y217 (≠ H187)
- binding alpha-D-glucopyranose: Y236 (vs. gap), I254 (≠ R217), Q256 (≠ S219)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ C14), G40 (= G15), K41 (≠ S16), Y42 (≠ I17), S64 (≠ D38), G65 (≠ P39), K69 (≠ R43), Y87 (≠ W63), L106 (≠ A77), P107 (= P78), N108 (≠ P79), L110 (= L81), H111 (= H82), E128 (= E99), K129 (= K100), R157 (≠ M128), A196 (= A169), W199 (vs. gap), R200 (vs. gap), Y217 (≠ H187), Y296 (≠ L255)
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
27% identity, 53% coverage: 10:334/608 of query aligns to 37:375/383 of 1h6dA
- active site: K131 (= K100), Y219 (≠ H187)
- binding glycerol: K131 (= K100), R202 (vs. gap), D215 (= D183), Y219 (≠ H187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G13), L41 (≠ C14), G42 (= G15), K43 (≠ S16), Y44 (≠ I17), S66 (≠ D38), G67 (≠ P39), K71 (≠ R43), Y89 (≠ W63), I107 (≠ A76), L108 (≠ A77), P109 (= P78), N110 (≠ P79), H113 (= H82), E130 (= E99), K131 (= K100), R159 (≠ M128), A198 (= A169), W201 (vs. gap), R202 (vs. gap), Y219 (≠ H187), Y298 (≠ L255)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
23% identity, 45% coverage: 60:334/608 of query aligns to 49:344/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K100), R150 (= R156), W157 (= W163), F160 (≠ M170), D173 (= D183), H177 (= H187)
- binding nicotinamide-adenine-dinucleotide: D51 (= D62), Y52 (≠ W63), C67 (≠ A76), T68 (≠ A77), P69 (= P78), H73 (= H82), E90 (= E99), K91 (= K100), P92 (= P101), Q119 (≠ M128), V159 (≠ I165), F160 (≠ M170), Q166 (≠ A176)
Sites not aligning to the query:
7xreC Crystal structure of dgpa
31% identity, 25% coverage: 60:211/608 of query aligns to 59:206/363 of 7xreC
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
27% identity, 53% coverage: 10:334/608 of query aligns to 6:332/340 of 1evjA
- active site: K100 (= K100), Y188 (≠ H187)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), L10 (≠ C14), G11 (= G15), K12 (≠ S16), Y13 (≠ I17), D35 (= D38), L77 (≠ A77), P78 (= P78), N79 (≠ P79), H82 (= H82), E99 (= E99), K100 (= K100), R128 (≠ M128), W170 (vs. gap), R171 (vs. gap), Y188 (≠ H187), Y267 (≠ L255)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
24% identity, 52% coverage: 8:326/608 of query aligns to 6:331/342 of 3ceaA
- active site: K98 (= K100), H185 (= H187)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), G13 (= G15), R14 (≠ S16), L15 (≠ I17), L38 (≠ V37), Q42 (≠ R43), V74 (≠ A76), A75 (= A77), P76 (= P78), T77 (≠ P79), F79 (≠ L81), H80 (= H82), M83 (≠ V85), E97 (= E99), K98 (= K100), M127 (= M128), F169 (≠ L171), H185 (= H187), F286 (= F285)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
28% identity, 31% coverage: 8:198/608 of query aligns to 4:187/336 of 3ec7A
- active site: K97 (= K100), H176 (= H187)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), M12 (≠ S16), I13 (= I17), D35 (= D38), I36 (≠ P39), R40 (= R43), T73 (≠ A76), A74 (= A77), S75 (≠ P78), N76 (≠ P79), H79 (= H82), E96 (= E99), K97 (= K100), M126 (= M128)
Sites not aligning to the query:
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
29% identity, 33% coverage: 59:257/608 of query aligns to 59:279/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: T79 (≠ A77), P80 (= P78), N81 (≠ P79), H84 (= H82), E101 (= E99), K102 (= K100), W173 (≠ L171), R174 (= R172)
- binding alpha-L-sorbopyranose: K102 (= K100), Y131 (≠ R129), Y159 (≠ F159), Q161 (≠ Y161), W163 (= W163), R174 (= R172), D187 (= D183)
Sites not aligning to the query:
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
31% identity, 33% coverage: 59:257/608 of query aligns to 60:275/372 of 6a3iA
- binding Levoglucosan: K103 (= K100), Y132 (≠ R129), Y160 (≠ F159), Q162 (≠ Y161), R175 (= R172), D188 (= D183), H192 (= H187)
- binding 1,4-dihydronicotinamide adenine dinucleotide: P81 (= P78), N82 (≠ P79), L84 (= L81), H85 (= H82), E102 (= E99), K103 (= K100), W174 (≠ L171), R175 (= R172)
Sites not aligning to the query:
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
26% identity, 53% coverage: 8:332/608 of query aligns to 9:346/347 of 3q2kC
- active site: K100 (= K100), H188 (= H187)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ S16), K100 (= K100), W159 (≠ F159), T160 (≠ V160), R161 (≠ Y161), Y165 (≠ I165), N184 (≠ D183), Q185 (≠ T184), H188 (= H187), Q243 (≠ R236), N244 (≠ A237)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G15), R17 (≠ S16), I18 (= I17), D40 (= D38), T41 (≠ P39), A76 (= A76), T77 (≠ A77), S79 (≠ P79), H82 (= H82), Q85 (≠ V85), E99 (= E99), K100 (= K100), Q128 (≠ M128), W171 (≠ L171), R172 (= R172)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
26% identity, 32% coverage: 8:203/608 of query aligns to 4:197/340 of 4n54A
- active site: K96 (= K100), H183 (= H187)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (≠ S16), K96 (= K100), D156 (vs. gap), D179 (= D183), M180 (≠ T184), H183 (= H187)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ I12), G9 (= G13), L10 (≠ C14), G11 (= G15), R12 (≠ S16), L13 (≠ I17), S35 (≠ D38), V36 (≠ P39), E40 (≠ R43), S73 (≠ A77), P74 (= P78), F77 (≠ L81), H78 (= H82), E95 (= E99), K96 (= K100), M125 (= M128), F167 (≠ L171)
Sites not aligning to the query:
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: 238, 244
- binding 1,4-dihydronicotinamide adenine dinucleotide: 284
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
28% identity, 33% coverage: 59:257/608 of query aligns to 61:291/390 of F0M433
- T81 (≠ A77) binding
- N83 (≠ P79) binding
- H86 (= H82) binding
- E103 (= E99) binding
- K104 (= K100) binding ; binding
- A130 (≠ G126) binding
- N132 (≠ M128) binding
- Y133 (≠ R129) binding
- Q163 (≠ Y161) binding
- W175 (≠ L171) binding
- R176 (= R172) binding ; binding
- D189 (= D183) binding
- H193 (= H187) binding
Sites not aligning to the query:
- 13 binding
- 14 binding
- 43 binding
- 335 binding
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
26% identity, 53% coverage: 8:332/608 of query aligns to 4:321/322 of 3q2kK
- active site: K95 (= K100), H183 (= H187)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ S16), K95 (= K100), T155 (≠ V160), R156 (≠ Y161), Y160 (≠ I165), N179 (≠ D183), Q180 (≠ T184), H183 (= H187), N239 (≠ A237)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G13), G11 (= G15), R12 (≠ S16), I13 (= I17), D35 (= D38), T36 (≠ P39), T72 (≠ A77), P73 (= P78), S74 (≠ P79), L76 (= L81), H77 (= H82), E94 (= E99), K95 (= K100), Q123 (≠ M128), W166 (≠ L171), R167 (= R172), H183 (= H187)
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
29% identity, 41% coverage: 8:256/608 of query aligns to 3:254/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ S16), F152 (≠ A155), N154 (= N162), D175 (= D183), L176 (≠ T184), H179 (= H187), E236 (≠ L238)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G15), F11 (≠ S16), M12 (≠ I17), D33 (= D38), L34 (≠ P39), T70 (≠ A76), T71 (≠ A77), P72 (= P78), N73 (≠ P79), L75 (= L81), H76 (= H82), Q79 (≠ V85), E93 (= E99), K94 (= K100), N122 (≠ R130), W161 (≠ A169), H179 (= H187)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
Query Sequence
>AZOBR_RS22955 FitnessBrowser__azobra:AZOBR_RS22955
MTNAEFPRLAIIGCGSIVSHHLLPALLRLGWRPSVLVDPTPGRLEAVQAMLGRNRAPVAV
ADWREAADQFDAALVAAPPMLHAPVGQSLLEAGKHVFMEKPLAVALADAERMAQTAEERR
RVLAVGLMRRYVNGVRWLKALIDSGQLGRVLRFEAREGFVYNWGISSPAMLRRDGAGGGV
LLDTGSHTLDLLLWWFGEAAEVDYSDDSYGGLESDCRLSLTMASGATGTLELSRTRALRN
TIRVYGTKGSVEVHLYENQIASDVPQILDFVHDGFSANHIPPQIFGDLFQAELKDFADAI
RDGRPAAVGGREALPSTALIERCYASRKPLALPWVDANAAASPRTDGPLADGPTVVVTGA
AGFIGGRLVERLCLEHGARVRCIVRDIAQAVRLARFPVEIVRADLLDREAIGKAVAGADW
VFHCAYDVRSRRQNIEGMNALIDASLANGVESFVHLSTFSVYEPLPDGPLSEETRDGDRA
WSYVQNKLDLEAMVLDAAQKRGLPGVVLQPSIVYGPFCKPWTNAPAEMLLSGTVVLPQEG
GLCNAVYIDDLVDAMIAGDAQPPGHRGALRDPPAPTPPPWARRLRALPGGAWAWTACASN
PPRPSARR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory