SitesBLAST
Comparing AZOBR_RS23050 FitnessBrowser__azobra:AZOBR_RS23050 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6a50A Structure of benzoylformate decarboxylases in complex with cofactor tpp
29% identity, 99% coverage: 5:512/515 of query aligns to 10:520/527 of 6a50A
- binding magnesium ion: N117 (≠ G117), L118 (= L118), R120 (≠ K120), D428 (= D413), N455 (= N440), T457 (≠ R442)
- binding thiamine diphosphate: N23 (= N22), P24 (= P23), E47 (= E48), H70 (= H71), T377 (≠ I362), S378 (= S363), G401 (= G386), L403 (≠ I388), G427 (≠ A412), D428 (= D413), G429 (= G414), S430 (= S415), Y433 (= Y418), N455 (= N440), T457 (≠ R442), Y458 (= Y443), G459 (= G444), M460 (≠ I445), L461 (= L446)
3fznA Intermediate analogue in benzoylformate decarboxylase (see paper)
29% identity, 99% coverage: 5:512/515 of query aligns to 9:519/523 of 3fznA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ S26), E27 (= E27), E46 (= E48), H69 (= H71), L108 (≠ P110), L109 (= L111), T110 (= T112), N111 (≠ S113), Y159 (≠ S160), P253 (≠ D255), H280 (≠ G280), S375 (≠ G361), G400 (= G386), L402 (≠ I388), D427 (= D413), N454 (= N440), T456 (≠ R442), Y457 (= Y443), A459 (≠ I445), L460 (= L446), F463 (≠ E449)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(S)-hydroxy[(R)-hydroxy(methoxy)phosphoryl]phenylmethyl}-5-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: N22 (= N22), P23 (= P23), G24 (= G24), S25 (≠ T25), E46 (= E48), H69 (= H71), H280 (≠ G280), T376 (≠ I362), S377 (= S363), G400 (= G386), L402 (≠ I388), G426 (≠ A412), D427 (= D413), G428 (= G414), S429 (= S415), Y432 (= Y418), N454 (= N440), T456 (≠ R442), Y457 (= Y443), G458 (= G444), A459 (≠ I445)
- binding magnesium ion: D427 (= D413), N454 (= N440), T456 (≠ R442)
- binding phosphate ion: Q286 (≠ S286), L288 (= L288), K289 (≠ A289), P290 (= P290)
1bfdA Benzoylformate decarboxylase from pseudomonas putida (see paper)
29% identity, 99% coverage: 5:512/515 of query aligns to 9:519/523 of 1bfdA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ S26), E27 (= E27), E46 (= E48), H69 (= H71), L108 (≠ P110), L109 (= L111), T110 (= T112), N111 (≠ S113), Y159 (≠ S160), P253 (≠ D255), H280 (≠ G280), S375 (≠ G361), G400 (= G386), L402 (≠ I388), D427 (= D413), N454 (= N440), T456 (≠ R442), Y457 (= Y443), A459 (≠ I445), L460 (= L446), F463 (≠ E449)
- binding calcium ion: D427 (= D413), N454 (= N440), T456 (≠ R442)
- binding magnesium ion: N116 (≠ G117), L117 (= L118), R119 (≠ K120)
- binding thiamine diphosphate: T376 (≠ I362), S377 (= S363), L402 (≠ I388), G426 (≠ A412), D427 (= D413), G428 (= G414), S429 (= S415), Y432 (= Y418), T456 (≠ R442), Y457 (= Y443), G458 (= G444), A459 (≠ I445), L460 (= L446)
5deiA Benzoylformate decarboxylase from pseudomonas putida
29% identity, 99% coverage: 5:512/515 of query aligns to 9:519/524 of 5deiA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ S26), E27 (= E27), E46 (= E48), H69 (= H71), L108 (≠ P110), L109 (= L111), T110 (= T112), N111 (≠ S113), Y159 (≠ S160), P253 (≠ D255), H280 (≠ G280), S375 (≠ G361), G400 (= G386), L402 (≠ I388), D427 (= D413), N454 (= N440), T456 (≠ R442), Y457 (= Y443), A459 (≠ I445), L460 (= L446), F463 (≠ E449)
- binding bicarbonate ion: S25 (≠ T25), H69 (= H71), L109 (= L111)
- binding calcium ion: N185 (≠ G198), D186 (≠ E199), D427 (= D413), N454 (= N440), T456 (≠ R442)
- binding magnesium ion: N116 (≠ G117), L117 (= L118), R119 (≠ K120)
- binding thiamine diphosphate: N22 (= N22), P23 (= P23), E46 (= E48), H69 (= H71), T376 (≠ I362), S377 (= S363), L402 (≠ I388), G426 (≠ A412), D427 (= D413), G428 (= G414), S429 (= S415), Y432 (= Y418), T456 (≠ R442), Y457 (= Y443), G458 (= G444), A459 (≠ I445), L460 (= L446)
Sites not aligning to the query:
3fsjX Crystal structure of benzoylformate decarboxylase in complex with the inhibitor mbp (see paper)
29% identity, 99% coverage: 5:512/515 of query aligns to 9:519/524 of 3fsjX
- active site: G24 (= G24), S25 (≠ T25), E27 (= E27), E46 (= E48), H69 (= H71), L108 (≠ P110), L109 (= L111), T110 (= T112), N111 (≠ S113), H280 (≠ G280), G400 (= G386), D427 (= D413), N454 (= N440), T456 (≠ R442), Y457 (= Y443), A459 (≠ I445), L460 (= L446)
- binding calcium ion: D427 (= D413), N454 (= N440), T456 (≠ R442)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(S)-hydroxy[(R)-hydroxy(methoxy)phosphoryl]phenylmethyl}-5-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: H280 (≠ G280), T376 (≠ I362), S377 (= S363), F396 (≠ T382), G400 (= G386), L402 (≠ I388), G426 (≠ A412), D427 (= D413), G428 (= G414), S429 (= S415), Y432 (= Y418), T456 (≠ R442), Y457 (= Y443), G458 (= G444), A459 (≠ I445), L460 (= L446), F463 (≠ E449)
Sites not aligning to the query:
3f6bX Crystal structure of benzoylformate decarboxylase in complex with the pyridyl inhibitor paa (see paper)
29% identity, 99% coverage: 5:512/515 of query aligns to 9:519/525 of 3f6bX
- active site: G24 (= G24), E46 (= E48), L108 (≠ P110), L109 (= L111), T110 (= T112), N111 (≠ S113), G400 (= G386), D427 (= D413), N454 (= N440), T456 (≠ R442), Y457 (= Y443), A459 (≠ I445), L460 (= L446)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-2-[(1S,2E)-1-hydroxy-3-pyridin-3-ylprop-2-en-1-yl]-4-methyl-1,3-thiazol-3-ium: N22 (= N22), P23 (= P23), G24 (= G24), S25 (≠ T25), E46 (= E48), H69 (= H71)
Sites not aligning to the query:
1mczA Benzoylformate decarboxylase from pseudomonas putida complexed with an inhibitor, r-mandelate (see paper)
29% identity, 99% coverage: 5:512/515 of query aligns to 9:519/524 of 1mczA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ S26), E27 (= E27), E46 (= E48), H69 (= H71), L108 (≠ P110), L109 (= L111), T110 (= T112), N111 (≠ S113), Y159 (≠ S160), P253 (≠ D255), H280 (≠ G280), S375 (≠ G361), G400 (= G386), L402 (≠ I388), D427 (= D413), N454 (= N440), T456 (≠ R442), Y457 (= Y443), A459 (≠ I445), L460 (= L446), F463 (≠ E449)
- binding magnesium ion: N116 (≠ G117), L117 (= L118), R119 (≠ K120), D427 (= D413), N454 (= N440), T456 (≠ R442)
- binding (r)-mandelic acid: S25 (≠ T25), H69 (= H71), L109 (= L111), H280 (≠ G280), T376 (≠ I362), F463 (≠ E449)
- binding thiamine diphosphate: N22 (= N22), P23 (= P23), E46 (= E48), H69 (= H71), T376 (≠ I362), S377 (= S363), G400 (= G386), L402 (≠ I388), G426 (≠ A412), D427 (= D413), G428 (= G414), S429 (= S415), Y432 (= Y418), Y457 (= Y443), G458 (= G444), A459 (≠ I445), L460 (= L446)
Sites not aligning to the query:
1pi3A E28q mutant benzoylformate decarboxylase from pseudomonas putida
29% identity, 99% coverage: 5:512/515 of query aligns to 9:519/523 of 1pi3A
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ S26), Q27 (≠ E27), E46 (= E48), H69 (= H71), L108 (≠ P110), L109 (= L111), T110 (= T112), N111 (≠ S113), Y159 (≠ S160), P253 (≠ D255), H280 (≠ G280), S375 (≠ G361), G400 (= G386), L402 (≠ I388), D427 (= D413), N454 (= N440), T456 (≠ R442), Y457 (= Y443), A459 (≠ I445), L460 (= L446), F463 (≠ E449)
- binding calcium ion: D427 (= D413), N454 (= N440), T456 (≠ R442)
- binding magnesium ion: N116 (≠ G117), L117 (= L118), R119 (≠ K120)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: T376 (≠ I362), S377 (= S363), L402 (≠ I388), G426 (≠ A412), G428 (= G414), S429 (= S415), Y432 (= Y418), N454 (= N440), T456 (≠ R442), Y457 (= Y443), G458 (= G444), A459 (≠ I445), L460 (= L446)
6qsiA Pseudomonas fluorescens pf-5 thiamine diphosphate-dependent 4- hydroxybenzoylformate decarboxylase (see paper)
30% identity, 97% coverage: 11:512/515 of query aligns to 11:519/525 of 6qsiA
- active site: N22 (= N22), G24 (= G24), S25 (≠ T25), N26 (≠ S26), E27 (= E27), E46 (= E48), H69 (= H71), M108 (≠ P110), L109 (= L111), A110 (≠ T112), Y159 (≠ W164), P253 (vs. gap), H280 (≠ S286), S375 (≠ G361), G400 (= G386), L402 (≠ I388), Y457 (= Y443), A459 (≠ I445), L460 (= L446), F463 (≠ E449)
- binding thiamine diphosphate: N22 (= N22), P23 (= P23), E46 (= E48), H69 (= H71), T376 (≠ I362), S377 (= S363), L402 (≠ I388), G426 (≠ A412), G428 (= G414), S429 (= S415), Y432 (= Y418), N454 (= N440), T456 (≠ R442), Y457 (= Y443), G458 (= G444), A459 (≠ I445), L460 (= L446)
7orxCCC jostii RHA1 thiamine diphosphate-dependent 4-hydroxybenzoylformate decarboxylase
29% identity, 99% coverage: 4:512/515 of query aligns to 8:523/531 of 7orxCCC
- active site: N26 (= N22), G28 (= G24), S29 (≠ T25), N30 (≠ S26), E31 (= E27), E50 (= E48), H73 (= H71), M112 (≠ P110), L113 (= L111), S114 (≠ T112), N115 (≠ S113), Y163 (≠ W164), P257 (≠ D255), H284 (≠ Y281), S379 (≠ G361), G404 (= G386), L406 (≠ I388), D431 (= D413), N458 (= N440), T460 (≠ R442), Y461 (= Y443), A463 (≠ I445), L464 (= L446), F467 (= F455)
- binding thiamine diphosphate: N26 (= N22), S29 (≠ T25), E50 (= E48), H73 (= H71), T380 (≠ I362), S381 (= S363), G404 (= G386), L406 (≠ I388), G430 (≠ A412), G432 (= G414), S433 (= S415), Y436 (= Y418), N458 (= N440), T460 (≠ R442), Y461 (= Y443), G462 (= G444)
4q9dB X-ray structure of a putative thiamin diphosphate-dependent enzyme isolated from mycobacterium smegmatis (see paper)
27% identity, 98% coverage: 7:511/515 of query aligns to 12:513/519 of 4q9dB
- active site: N24 (= N22), G26 (= G24), S27 (≠ T25), T28 (≠ S26), E29 (= E27), Q47 (≠ F47), E48 (= E48), H71 (= H71), V107 (= V107), D108 (= D108), Y110 (≠ P110), L111 (= L111), N112 (≠ T112), N113 (≠ S113), L161 (≠ S160), P252 (= P253), Y279 (= Y281), M374 (≠ D359), S376 (≠ G361), G401 (= G386), I403 (= I388), D432 (= D413), N459 (= N440), E461 (≠ R442), Y462 (= Y443), I464 (= I445)
- binding magnesium ion: D432 (= D413), N459 (= N440), E461 (≠ R442)
Sites not aligning to the query:
4k9qA The crystal structure of benzoylformate decarboxylase from polynucleobacter necessarius
24% identity, 98% coverage: 5:511/515 of query aligns to 6:520/531 of 4k9qA
- active site: N23 (= N22), G25 (= G24), S26 (≠ T25), T27 (≠ S26), E28 (= E27), E47 (= E48), H70 (= H71), N106 (≠ D108), E107 (≠ A109), L110 (≠ T112), T111 (≠ S113), L160 (≠ S160), T251 (vs. gap), Y278 (= Y281), V370 (= V358), C373 (≠ G361), G398 (= G386), L400 (≠ I388), D429 (= D413), N456 (= N440), E458 (≠ R442), Y459 (= Y443), G460 (= G444), I461 (= I445), L462 (= L446), F465 (= F455)
- binding magnesium ion: D429 (= D413), N456 (= N440), E458 (≠ R442)
- binding thiamine diphosphate: P374 (≠ I362), S375 (= S363), L400 (≠ I388), G428 (≠ A412), D429 (= D413), G430 (= G414), S431 (= S415), Y434 (= Y418), N456 (= N440), E458 (≠ R442), Y459 (= Y443), G460 (= G444), I461 (= I445), L462 (= L446)
Sites not aligning to the query:
4qq8C Crystal structure of the formolase fls in space group p 43 21 2 (see paper)
27% identity, 100% coverage: 1:515/515 of query aligns to 3:543/569 of 4qq8C
- active site: L24 (≠ T25), G26 (≠ E27), I27 (≠ L28), H28 (= H29), I29 (≠ A30), E49 (= E48), T72 (≠ H71), L111 (≠ W103), Q112 (≠ H104), A113 (≠ R105), G114 (= G106), W162 (≠ S160), L255 (≠ V247), T283 (≠ I270), G392 (≠ E360), N418 (≠ T382), M420 (≠ I388), D447 (= D413), N474 (= N440), S476 (≠ R442), W477 (≠ Y443), W479 (= W448), T480 (≠ N452), F483 (= F455)
- binding magnesium ion: D447 (= D413), N474 (= N440), S476 (≠ R442)
- binding thiamine diphosphate: H25 (≠ S26), E49 (= E48), Q112 (≠ H104), G392 (≠ E360), G393 (= G361), L394 (≠ I362), T395 (≠ S363), N418 (≠ T382), M420 (≠ I388), G446 (≠ A412), D447 (= D413), G448 (= G414), S449 (= S415), Y452 (= Y418), N474 (= N440), S476 (≠ R442), W477 (≠ Y443), G478 (= G444), W479 (= W448), T480 (≠ N452)
Sites not aligning to the query:
3d7kA Crystal structure of benzaldehyde lyase in complex with the inhibitor mbp (see paper)
26% identity, 100% coverage: 1:515/515 of query aligns to 3:543/554 of 3d7kA
- active site: L24 (≠ N22), G26 (= G24), A27 (≠ T25), H28 (= H29), I29 (≠ A30), E49 (= E48), T72 (≠ H71), L111 (≠ W103), Q112 (≠ H104), A113 (≠ R105), G114 (= G106), W162 (≠ S160), L255 (≠ V247), T283 (≠ I270), G392 (= G361), G418 (= G386), M420 (≠ I388), D447 (= D413), N474 (= N440), S476 (≠ R442), W477 (≠ Y443), A479 (≠ G451), T480 (≠ N452), F483 (= F455)
- binding calcium ion: D447 (= D413), N474 (= N440), S476 (≠ R442)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(S)-hydroxy[(R)-hydroxy(methoxy)phosphoryl]phenylmethyl}-5-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: H25 (≠ P23), G26 (= G24), A27 (≠ T25), E49 (= E48), T72 (≠ H71), Q112 (≠ H104), G392 (= G361), A393 (≠ I362), L394 (vs. gap), T395 (vs. gap), G418 (= G386), M420 (≠ I388), G446 (≠ A412), D447 (= D413), G448 (= G414), S449 (= S415), Y452 (= Y418), N474 (= N440), S476 (≠ R442), W477 (≠ Y443), G478 (= G444), A479 (≠ G451), T480 (≠ N452)
Sites not aligning to the query:
6lpiB Crystal structure of ahas holo-enzyme (see paper)
25% identity, 96% coverage: 3:497/515 of query aligns to 8:509/539 of 6lpiB
- active site: I27 (≠ N22), G29 (= G24), G30 (≠ T25), S31 (= S26), I32 (≠ E27), E53 (= E48), C76 (≠ H71), F115 (≠ P110), Q116 (≠ L111), E117 (≠ T112), K165 (≠ S160), M256 (≠ L261), A283 (vs. gap), V375 (≠ G361), G401 (= G386), M403 (≠ I388), D428 (= D413), N455 (= N440), A457 (≠ R442), L458 (≠ Y443), L460 (≠ I445), V461 (≠ L446), Q464 (≠ E449)
- binding flavin-adenine dinucleotide: R155 (≠ P150), G212 (≠ N206), G213 (= G207), G214 (= G219), T236 (≠ G241), L237 (≠ A242), M238 (≠ G243), L254 (≠ A259), M256 (≠ L261), H257 (≠ A262), G276 (= G280), A277 (vs. gap), R278 (vs. gap), D280 (≠ P282), R282 (vs. gap), A283 (vs. gap), D300 (vs. gap), I301 (vs. gap), D319 (vs. gap), V320 (vs. gap), M380 (≠ P366), G398 (≠ T384)
- binding magnesium ion: D428 (= D413), N455 (= N440)
- binding thiamine diphosphate: E53 (= E48), C76 (≠ H71), P79 (= P74), G376 (≠ I362), Q377 (≠ S363), H378 (≠ S364), G401 (= G386), M403 (≠ I388), G427 (≠ A412), D428 (= D413), G429 (= G414), S430 (= S415), M433 (≠ Y418), N455 (= N440), A457 (≠ R442), L458 (≠ Y443), G459 (= G444), L460 (≠ I445), V461 (≠ L446)
6wo1A Hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit (see paper)
31% identity, 44% coverage: 1:225/515 of query aligns to 9:234/551 of 6wo1A
- active site: Y30 (≠ N22), G32 (= G24), G33 (≠ T25), A34 (≠ S26), I35 (≠ E27), E56 (= E48), T79 (≠ H71), F118 (≠ P110), Q119 (≠ L111), E120 (≠ T112), K168 (≠ S160)
- binding flavin-adenine dinucleotide: D97 (≠ A89), R158 (≠ P150), G208 (vs. gap), G210 (= G207), S213 (≠ T210)
Sites not aligning to the query:
- active site: 255, 282, 398, 424, 426, 451, 478
- binding 2-methylpyrimidin-4-amine: 424, 425, 426
- binding diphosphate: 398, 399, 400, 401, 450, 451, 452, 453
- binding flavin-adenine dinucleotide: 235, 236, 237, 253, 254, 255, 275, 276, 277, 279, 281, 282, 308, 309, 327, 328, 402, 421, 422
- binding magnesium ion: 451, 478
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
27% identity, 39% coverage: 1:203/515 of query aligns to 14:216/599 of 6denA
- active site: Y35 (≠ N22), G37 (= G24), G38 (≠ T25), A39 (≠ S26), I40 (≠ E27), E61 (= E48), T84 (≠ H71), F123 (≠ P110), Q124 (≠ L111), E125 (≠ T112), K173 (≠ S160)
- binding flavin-adenine dinucleotide: R163 (≠ P150)
Sites not aligning to the query:
- active site: 230, 266, 293, 409, 434, 435, 437, 462, 489, 491, 492, 494, 495, 498, 520, 525, 526
- binding flavin-adenine dinucleotide: 219, 220, 221, 224, 246, 247, 248, 264, 286, 287, 288, 290, 292, 293, 319, 320, 324, 338, 339, 414, 432
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: 266, 291, 292, 498
- binding magnesium ion: 462, 489, 491
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: 409, 410, 411, 412, 435, 437, 461, 462, 463, 464, 489, 491, 492, 493, 494, 495
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
26% identity, 39% coverage: 1:203/515 of query aligns to 12:214/597 of 6demA
- active site: Y33 (≠ N22), G35 (= G24), G36 (≠ T25), A37 (≠ S26), I38 (≠ E27), E59 (= E48), T82 (≠ H71), F121 (≠ P110), Q122 (≠ L111), E123 (≠ T112), K171 (≠ S160)
- binding flavin-adenine dinucleotide: R161 (≠ P150)
Sites not aligning to the query:
- active site: 228, 264, 291, 407, 432, 433, 435, 460, 487, 489, 490, 492, 493, 496, 518, 523, 524
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: 264, 289, 290, 492, 496, 567
- binding flavin-adenine dinucleotide: 217, 218, 219, 222, 244, 245, 246, 262, 284, 285, 286, 288, 290, 291, 317, 318, 322, 336, 337, 412, 430
- binding magnesium ion: 460, 487, 489
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: 407, 408, 409, 410, 435, 459, 460, 461, 462, 465, 487, 489, 490, 491, 492, 493
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
26% identity, 39% coverage: 1:203/515 of query aligns to 12:214/597 of 6delA
- active site: Y33 (≠ N22), G35 (= G24), G36 (≠ T25), A37 (≠ S26), I38 (≠ E27), E59 (= E48), T82 (≠ H71), F121 (≠ P110), Q122 (≠ L111), E123 (≠ T112), K171 (≠ S160)
- binding flavin-adenine dinucleotide: R161 (≠ P150)
Sites not aligning to the query:
- active site: 228, 264, 291, 407, 432, 433, 435, 460, 487, 489, 490, 492, 493, 496, 518, 523, 524
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: 289, 290, 496
- binding flavin-adenine dinucleotide: 217, 218, 219, 222, 244, 245, 246, 262, 284, 285, 286, 288, 290, 291, 317, 318, 322, 336, 337, 412, 430
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: 407, 408, 409, 410, 433, 435, 459, 460, 461, 462, 465, 487, 489, 490, 491, 492, 493
- binding magnesium ion: 460, 487, 489
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: 407, 408, 409, 410, 433, 435, 459, 460, 461, 462, 465, 487, 489, 490, 491, 492, 493
4d5eB Crystal structure of recombinant wildtype cdh (see paper)
32% identity, 31% coverage: 352:512/515 of query aligns to 389:541/587 of 4d5eB
- active site: I397 (≠ E360), G423 (= G386), L425 (≠ I388), D450 (= D413), N477 (= N440), S479 (≠ R442), Y480 (= Y443), A482 (≠ I445), N483 (≠ Q447), L486 (= L450)
- binding flavin-adenine dinucleotide: F405 (≠ V368), M420 (≠ I383)
- binding magnesium ion: D450 (= D413), N477 (= N440), S479 (≠ R442)
- binding thiamine diphosphate: I397 (≠ E360), G398 (= G361), N399 (≠ I362), H400 (≠ S363), L425 (≠ I388), G449 (≠ A412), D450 (= D413), G451 (= G414), A452 (≠ S415), Y455 (= Y418), N477 (= N440), S479 (≠ R442), Y480 (= Y443), G481 (= G444), N483 (≠ Q447)
Sites not aligning to the query:
- active site: 24, 26, 27, 28, 29, 51, 74, 114, 115, 163, 258, 285, 546
- binding flavin-adenine dinucleotide: 212, 213, 214, 217, 238, 239, 240, 256, 257, 258, 259, 278, 279, 280, 284, 285, 301, 302, 320, 321
- binding thiamine diphosphate: 24, 25, 51, 75
Query Sequence
>AZOBR_RS23050 FitnessBrowser__azobra:AZOBR_RS23050
IPGAEILVRTLVANGVDTCFANPGTSELHALAAFDSMPGARCVPTLFEGVATGAADGYAR
MTDRPAATLLHLGPGLANGLANLHNARRACVPMVNIVGDHATWHRGVDAPLTSDVEGLAK
PMSAWVRTVPDAASVAADTAEAIRAALTPPCGVSTLILPSDSSWDDTAAAEPIIVEPPAP
AAPDADALRAAADALRSGERVVVLLNGRATRTEGLALAGRIAAATGAKLYAHTGATRIER
GAGRVTVERFPYPIDLGIAALAGAKHVVLIGSGEPVGFFGYPDKPSRLAPEDCRIHTVAP
PGADALAALRWLAEAVGCAGTPVPAQPLAPPEPATGALTADSVGQSLAALLPEGAIVVDE
GISSSPMVYTACAGARAHDWLTITGGAIGIGMPLALGAAIACPDRKVVTVQADGSGMYTL
QALWSQARERADVVTIIFANRRYGILQWELGNLGFRDMGPNARNCTELGRPDLDWVALAR
GMGVEGGQATDAESFNRLLTAAFARKGPFLIEAVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory