Comparing AZOBR_RS23300 FitnessBrowser__azobra:AZOBR_RS23300 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
32% identity, 95% coverage: 4:293/304 of query aligns to 2:291/291 of 3na8A
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
35% identity, 94% coverage: 5:289/304 of query aligns to 2:288/294 of 4i7wA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
35% identity, 94% coverage: 5:289/304 of query aligns to 2:288/294 of Q8UGL3
Q9S4K9 N-acetylneuraminate lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Clostridium perfringens (strain 13 / Type A) (see paper)
30% identity, 92% coverage: 5:283/304 of query aligns to 1:279/288 of Q9S4K9
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
30% identity, 93% coverage: 8:291/304 of query aligns to 8:292/295 of 5ktlA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
30% identity, 94% coverage: 5:289/304 of query aligns to 2:286/292 of Q07607
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
29% identity, 93% coverage: 9:291/304 of query aligns to 6:291/296 of 7mjfA
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
29% identity, 93% coverage: 9:291/304 of query aligns to 6:291/296 of 7lvlA
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
30% identity, 91% coverage: 8:284/304 of query aligns to 10:286/307 of 4fhaA
4wozB Crystal structures of cdnal from clostridium difficile in complex with mannosamine
29% identity, 95% coverage: 4:292/304 of query aligns to 2:290/290 of 4wozB
4woqC Crystal structures of cdnal from clostridium difficile in complex with ketobutyric
29% identity, 95% coverage: 4:292/304 of query aligns to 2:290/290 of 4woqC
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
29% identity, 94% coverage: 4:290/304 of query aligns to 1:287/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
29% identity, 94% coverage: 4:290/304 of query aligns to 1:287/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
29% identity, 94% coverage: 4:290/304 of query aligns to 1:287/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
29% identity, 94% coverage: 4:290/304 of query aligns to 1:287/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
29% identity, 94% coverage: 4:290/304 of query aligns to 1:287/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
29% identity, 94% coverage: 4:290/304 of query aligns to 1:287/291 of 3pueB
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
28% identity, 94% coverage: 5:290/304 of query aligns to 3:291/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 94% coverage: 5:290/304 of query aligns to 2:290/294 of Q9X1K9
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
26% identity, 93% coverage: 7:290/304 of query aligns to 6:290/296 of 7kg2A
>AZOBR_RS23300 FitnessBrowser__azobra:AZOBR_RS23300
MSISLSGIIPPLVTPFTADGEIDEAAFRAQVRFMLQKGVHGVCVGGSTGEGHTLSTEELT
RLVAISCEEVDGAVPVVAGIIVNSTRDAIAKARALEHLPVAALQVTPVHYVFKPDEDATL
EHFRTLAGETRMPIVIYNVVPWNYLSPSLLVRIMKEIDSVIGVKQSAGDLKLMADLLNEQ
VPGKLVFTAVDALLYPSFALGAHGTIAANPAAVPGVTVALWNAVQAGDHPRALEIHRSLL
AFWNTINGDNLPGCVKHSLSRQGCEVGVPRQPMPAATEAQKARIDAALREVLRYEASPTT
AAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory