Comparing AZOBR_RS23365 FitnessBrowser__azobra:AZOBR_RS23365 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
60% identity, 99% coverage: 2:261/262 of query aligns to 5:264/265 of P07821
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 76% coverage: 35:234/262 of query aligns to 32:230/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 76% coverage: 35:234/262 of query aligns to 33:231/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 76% coverage: 35:234/262 of query aligns to 33:231/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 76% coverage: 35:234/262 of query aligns to 33:231/344 of 6cvlD
Sites not aligning to the query:
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
35% identity, 79% coverage: 39:244/262 of query aligns to 30:231/231 of 1l7vC
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
35% identity, 79% coverage: 39:244/262 of query aligns to 30:231/248 of 4fi3C
Sites not aligning to the query:
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
27% identity, 95% coverage: 6:254/262 of query aligns to 2:251/501 of P04983
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 86% coverage: 7:232/262 of query aligns to 16:235/378 of P69874
Sites not aligning to the query:
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
31% identity, 94% coverage: 5:249/262 of query aligns to 2:244/278 of 8bmpA
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
30% identity, 90% coverage: 28:262/262 of query aligns to 27:269/310 of 4fwiB
Sites not aligning to the query:
5d3mA Folate ecf transporter: amppnp bound state (see paper)
31% identity, 81% coverage: 37:249/262 of query aligns to 36:247/280 of 5d3mA
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 79% coverage: 29:234/262 of query aligns to 23:225/241 of 4u00A
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
34% identity, 87% coverage: 7:234/262 of query aligns to 3:229/280 of 5x40A
Q9LVM1 ABC transporter B family member 25, mitochondrial; ABC transporter ABCB.25; AtABCB25; ABC transporter of the mitochondrion 3; AtATM3; Iron-sulfur clusters transporter ATM3; Protein STARIK 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 85% coverage: 10:233/262 of query aligns to 480:701/728 of Q9LVM1
7n5aA Structure of atatm3 in the closed conformation (see paper)
29% identity, 85% coverage: 10:233/262 of query aligns to 353:574/589 of 7n5aA
7n59A Structure of atatm3 in the inward-facing conformation with gssg bound (see paper)
29% identity, 85% coverage: 10:233/262 of query aligns to 354:575/590 of 7n59A
Sites not aligning to the query:
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
31% identity, 81% coverage: 37:249/262 of query aligns to 33:244/278 of 8bmsA
Sites not aligning to the query:
G7CBF5 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
33% identity, 95% coverage: 10:259/262 of query aligns to 655:900/908 of G7CBF5
Sites not aligning to the query:
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
32% identity, 79% coverage: 10:215/262 of query aligns to 6:199/249 of 4hluC
>AZOBR_RS23365 FitnessBrowser__azobra:AZOBR_RS23365
MTPVTEPMFHLDGVRFALPGRLLLDLPSCDLFPHRVTALIGHNGSGKSTLLKILARQQPA
SSGRVLFDGRPLDRWKQRALARRIGYLPQHMPAASGLLVRELVALGRYPWHGALGAFRAE
DARKVEEALALTDTAPFADRLVDSLSGGERQRVWLAMLIAQDAGCLLLDEPISALDVAHQ
VEVLALVRRLSRERGIGVVAVLHDVNMAARFCDDIVALQGGRLIDRGAPAEIMTPARLRA
IYGLPMAVIPHPDSGQPVALVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory