SitesBLAST
Comparing AZOBR_RS23480 FitnessBrowser__azobra:AZOBR_RS23480 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
47% identity, 99% coverage: 3:395/398 of query aligns to 1:381/382 of 7ahhC
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: L275 (≠ I273), S297 (≠ E308), S298 (≠ F309)
- binding phosphoaminophosphonic acid-adenylate ester: F12 (= F14), T39 (= T41), V40 (= V42), G41 (= G43), G62 (= G64), G64 (= G66), K65 (= K67), D187 (= D189), E188 (= E190)
7aheC Opua inhibited inward facing (see paper)
47% identity, 99% coverage: 3:395/398 of query aligns to 1:381/382 of 7aheC
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: L275 (≠ I273), S297 (≠ E308), S298 (≠ F309)
7ahdC Opua (e190q) occluded (see paper)
58% identity, 65% coverage: 3:262/398 of query aligns to 1:260/260 of 7ahdC
- binding adenosine-5'-triphosphate: F12 (= F14), T39 (= T41), S61 (= S63), G62 (= G64), G64 (= G66), K65 (= K67), S66 (= S68), T67 (= T69), Q111 (= Q113), K161 (≠ R163), Q162 (≠ E164), S164 (= S166), G166 (= G168), M167 (= M169), Q188 (≠ E190), H221 (= H223)
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
40% identity, 58% coverage: 34:264/398 of query aligns to 12:242/375 of 2d62A
1g291 Malk (see paper)
38% identity, 60% coverage: 27:264/398 of query aligns to 2:239/372 of 1g291
- binding magnesium ion: D69 (≠ K94), E71 (≠ S96), K72 (≠ R97), K79 (≠ R104), D80 (≠ R105)
- binding pyrophosphate 2-: S38 (= S63), G39 (= G64), C40 (≠ S65), G41 (= G66), K42 (= K67), T43 (≠ S68), T44 (= T69)
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
37% identity, 60% coverage: 27:265/398 of query aligns to 2:234/371 of P68187
- A85 (= A116) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ S137) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A145) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A148) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D150) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ G155) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G168) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D189) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ D259) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
37% identity, 60% coverage: 27:265/398 of query aligns to 1:233/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ T38), S37 (= S63), G38 (= G64), C39 (≠ S65), G40 (= G66), K41 (= K67), S42 (= S68), T43 (= T69), Q81 (= Q113), R128 (≠ S160), A132 (≠ E164), S134 (= S166), G136 (= G168), Q137 (≠ M169), E158 (= E190), H191 (= H223)
- binding magnesium ion: S42 (= S68), Q81 (= Q113)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
37% identity, 60% coverage: 27:265/398 of query aligns to 1:233/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ T38), G38 (= G64), C39 (≠ S65), G40 (= G66), K41 (= K67), S42 (= S68), T43 (= T69), R128 (≠ S160), S134 (= S166), Q137 (≠ M169)
- binding beryllium trifluoride ion: S37 (= S63), G38 (= G64), K41 (= K67), Q81 (= Q113), S134 (= S166), G136 (= G168), H191 (= H223)
- binding magnesium ion: S42 (= S68), Q81 (= Q113)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
37% identity, 60% coverage: 27:265/398 of query aligns to 1:233/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ T38), V17 (≠ G43), G38 (= G64), C39 (≠ S65), G40 (= G66), K41 (= K67), S42 (= S68), T43 (= T69), R128 (≠ S160), A132 (≠ E164), S134 (= S166), Q137 (≠ M169)
- binding tetrafluoroaluminate ion: S37 (= S63), G38 (= G64), K41 (= K67), Q81 (= Q113), S134 (= S166), G135 (= G167), G136 (= G168), E158 (= E190), H191 (= H223)
- binding magnesium ion: S42 (= S68), Q81 (= Q113)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
37% identity, 60% coverage: 27:265/398 of query aligns to 1:233/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ T38), V17 (≠ G43), G38 (= G64), C39 (≠ S65), G40 (= G66), K41 (= K67), S42 (= S68), T43 (= T69), R128 (≠ S160), A132 (≠ E164), S134 (= S166), Q137 (≠ M169)
- binding magnesium ion: S42 (= S68), Q81 (= Q113)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
37% identity, 60% coverage: 27:265/398 of query aligns to 1:233/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
37% identity, 59% coverage: 32:265/398 of query aligns to 4:231/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ T38), S35 (= S63), G36 (= G64), C37 (≠ S65), G38 (= G66), K39 (= K67), S40 (= S68), T41 (= T69), R126 (≠ S160), A130 (≠ E164), S132 (= S166), G134 (= G168), Q135 (≠ M169)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 59% coverage: 51:284/398 of query aligns to 40:264/378 of P69874
- F45 (≠ I56) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ S65) mutation to T: Loss of ATPase activity and transport.
- L60 (≠ V71) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ I87) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V152) mutation to M: Loss of ATPase activity and transport.
- D172 (= D189) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 26 C→A: Lower ATPase activity and transport efficiency.
- 27 F→L: Lower ATPase activity and transport efficiency.
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 59% coverage: 33:267/398 of query aligns to 9:243/343 of P30750
- 40:46 (vs. 63:69, 86% identical) binding
- E166 (= E190) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 60% coverage: 27:265/398 of query aligns to 2:234/369 of P19566
- L86 (= L117) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (≠ A191) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D196) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
44% identity, 55% coverage: 49:268/398 of query aligns to 23:239/241 of 4u00A
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 59% coverage: 33:267/398 of query aligns to 10:244/344 of 6cvlD
- binding phosphothiophosphoric acid-adenylate ester: F12 (= F35), Q14 (≠ R37), I19 (≠ V42), S41 (= S63), G42 (= G64), A43 (≠ S65), G44 (= G66), K45 (= K67), S46 (= S68), T47 (= T69), N141 (≠ E164), S143 (= S166), Q146 (≠ M169), H200 (= H223)
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 59% coverage: 33:267/398 of query aligns to 10:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 59% coverage: 33:267/398 of query aligns to 10:244/344 of 3tuiC
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
38% identity, 59% coverage: 33:268/398 of query aligns to 6:239/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ T38), V16 (≠ G43), S36 (= S63), G37 (= G64), S38 (= S65), G39 (= G66), K40 (= K67), S41 (= S68), T42 (= T69), E162 (= E190), H194 (= H223)
- binding magnesium ion: S41 (= S68), E162 (= E190)
Query Sequence
>AZOBR_RS23480 FitnessBrowser__azobra:AZOBR_RS23480
MTAKIAVNGVTRIFGRHPRQALDLLKAGLSKEEIFKRTGQTVGVLDASFEVEAGEIFVIM
GLSGSGKSTLVRMLNRLIDPTAGEIRIDGRDITKLSRAELTELRRRDLGMVFQSFALLPH
LRVWENAAFGLEIAGESLKARRDKAQQALDAVGLGAYAESFPRELSGGMQQRVGLARALA
NEPSVLLMDEAFSALDPLIRTEMQDELLRLQAERQRTIVFISHDLDEAIRIGDRLAIMEG
GQIIQVGRPDEILKQPANDYVRSFFRNIDVTKILTAGDIARRDQVTLIRHTGEGPRAAVR
QLRERDREFGYVQDGRRRFHGVVSVETLVTAIERHNGSATLDEALLPGIEPLPVDLPMDE
VLPRIASAPCPLPVVDGQGAYVGAISKTAYLETLGRTR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory