Comparing AZOBR_RS23505 FitnessBrowser__azobra:AZOBR_RS23505 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
Q9HU77 Formimidoylglutamate deiminase; Formiminoglutamate deiminase; N-formimino-L-glutamate deiminase; N-formimino-L-glutamate iminohydrolase; EC 3.5.3.13 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
60% identity, 96% coverage: 1:445/462 of query aligns to 1:438/453 of Q9HU77
4rdvB The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-formimino-l-aspartate
60% identity, 96% coverage: 2:445/462 of query aligns to 1:437/451 of 4rdvB
3mduA The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-guanidino-l-glutamate (see paper)
60% identity, 96% coverage: 2:445/462 of query aligns to 1:437/450 of 3mduA
4f0lB Crystal structure of amidohydrolase from brucella melitensis
50% identity, 97% coverage: 8:455/462 of query aligns to 9:444/449 of 4f0lB
4dzhA Crystal structure of an adenosine deaminase from xanthomonas campestris (target nysgrc-200456) with bound zn
30% identity, 45% coverage: 226:433/462 of query aligns to 210:409/439 of 4dzhA
Sites not aligning to the query:
8is4A Structure of an isocytosine specific deaminase vcz in complexed with 5-fu (see paper)
24% identity, 85% coverage: 48:439/462 of query aligns to 58:426/452 of 8is4A
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
27% identity, 51% coverage: 205:440/462 of query aligns to 185:412/436 of 4f0rA
Sites not aligning to the query:
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
27% identity, 51% coverage: 205:440/462 of query aligns to 185:412/434 of 4f0sA
Sites not aligning to the query:
Q58936 5'-deoxyadenosine deaminase; 5'-dA deaminase; 5'-methylthioadenosine deaminase; MTA deaminase; Adenosine deaminase; S-adenosylhomocysteine deaminase; SAH deaminase; EC 3.5.4.41; EC 3.5.4.31; EC 3.5.4.4; EC 3.5.4.28 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
24% identity, 49% coverage: 231:456/462 of query aligns to 197:413/420 of Q58936
Sites not aligning to the query:
4gbdA Crystal structure of adenosine deaminase from pseudomonas aeruginosa pao1 with bound zn and methylthio-coformycin (see paper)
25% identity, 54% coverage: 202:452/462 of query aligns to 183:425/435 of 4gbdA
Sites not aligning to the query:
4dykA Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
25% identity, 54% coverage: 202:452/462 of query aligns to 183:425/437 of 4dykA
Sites not aligning to the query:
4v1xE The structure of the hexameric atrazine chlorohydrolase, atza (see paper)
25% identity, 85% coverage: 48:440/462 of query aligns to 58:436/474 of 4v1xE
P72156 Atrazine chlorohydrolase; EC 3.8.1.8 from Pseudomonas sp. (strain ADP) (see 2 papers)
25% identity, 85% coverage: 48:440/462 of query aligns to 58:436/474 of P72156
Q9EYU0 Melamine deaminase; EC 3.5.4.45 from Paracidovorax citrulli (Acidovorax citrulli) (see paper)
23% identity, 85% coverage: 48:440/462 of query aligns to 58:436/474 of Q9EYU0
3lnpA Crystal structure of amidohydrolase family protein olei01672_1_465 from oleispira antarctica (see paper)
23% identity, 53% coverage: 197:440/462 of query aligns to 183:418/441 of 3lnpA
Sites not aligning to the query:
2imrA Crystal structure of amidohydrolase dr_0824 from deinococcus radiodurans
28% identity, 42% coverage: 188:380/462 of query aligns to 155:360/380 of 2imrA
Sites not aligning to the query:
>AZOBR_RS23505 FitnessBrowser__azobra:AZOBR_RS23505
MNGLFCERALLPEGWASNVALRFDARGTLTAVERDASSDGLPRAAGPVIPGMPNLHSHAF
QRAMAGLTEYAGASEDSFWTWRDAMYGFVRRMTPEAAEAVAALLYMEMAKQGYTAVAEFH
YLHHSADGRPYADRAEMSRRILAAADTAGIGLTHLPVLYAHSGFGGKPPSDGQKRFINDV
DGLLSIVSAMEKAMGAERAGRRAGLALHSLRAVTPEEMRDALTGLDALDPGAPIHIHIAE
QTAEVDDCVAWSSKRPVEWLLENAPVGPRWCLVHATHVTPAEVDGMAASGAVAGLCLTTE
ANLGDGLFPAIPFLAQGGRFGVGSDSHISVSAAEELRLLEYGQRLVQRRRNVLRIGDCPS
IGGGLYRAAVAGGAQALGQPVTGGGVQVGQPADLVVLDADNPKLLSRTDDSLLDAYVFAS
DGHAVRDVIAAGRTVVREGRHVREDAIRAAYRRAIEGLRRDT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory