Comparing AZOBR_RS23565 FitnessBrowser__azobra:AZOBR_RS23565 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ezlA Rice l-galactose dehydrogenase (holo form)
31% identity, 91% coverage: 1:288/316 of query aligns to 18:281/318 of 7ezlA
7eziA Rice l-galactose dehydrogenase (apo form)
31% identity, 91% coverage: 1:288/316 of query aligns to 23:286/323 of 7eziA
7svqA Crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with NAD+ (see paper)
28% identity, 91% coverage: 1:287/316 of query aligns to 17:279/315 of 7svqA
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
29% identity, 91% coverage: 1:287/316 of query aligns to 16:290/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
29% identity, 91% coverage: 1:287/316 of query aligns to 15:289/311 of 1pz0A
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
28% identity, 94% coverage: 1:297/316 of query aligns to 17:279/298 of 1ynqB
Sites not aligning to the query:
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
28% identity, 94% coverage: 1:297/316 of query aligns to 17:279/298 of 1ynpB
Sites not aligning to the query:
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
26% identity, 97% coverage: 1:305/316 of query aligns to 23:323/326 of P77256
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
27% identity, 94% coverage: 1:297/316 of query aligns to 17:264/283 of 1ynpA
Sites not aligning to the query:
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
26% identity, 97% coverage: 1:305/316 of query aligns to 16:276/287 of 3v0sA
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
26% identity, 98% coverage: 1:310/316 of query aligns to 16:313/337 of Q3L181
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
27% identity, 88% coverage: 9:286/316 of query aligns to 19:272/301 of 6ow0B
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
26% identity, 86% coverage: 20:290/316 of query aligns to 45:296/315 of 5t79A
Sites not aligning to the query:
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
27% identity, 86% coverage: 20:290/316 of query aligns to 44:291/312 of 3erpA
Sites not aligning to the query:
4exaF Crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa (see paper)
28% identity, 89% coverage: 15:294/316 of query aligns to 45:258/259 of 4exaF
Sites not aligning to the query:
3n6qD Crystal structure of yghz from e. Coli (see paper)
28% identity, 84% coverage: 22:287/316 of query aligns to 46:288/315 of 3n6qD
Sites not aligning to the query:
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
26% identity, 88% coverage: 9:286/316 of query aligns to 19:296/323 of 6ow0A
6hg6A Clostridium beijerinckii aldo-keto reductase cbei_3974 with NADPH (see paper)
26% identity, 84% coverage: 26:292/316 of query aligns to 50:296/313 of 6hg6A
Sites not aligning to the query:
4aubE The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
27% identity, 84% coverage: 22:287/316 of query aligns to 46:276/297 of 4aubE
Sites not aligning to the query:
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
27% identity, 84% coverage: 22:287/316 of query aligns to 45:301/335 of 4aubB
Sites not aligning to the query:
>AZOBR_RS23565 FitnessBrowser__azobra:AZOBR_RS23565
IGFGGAPLGNMFEEVPDDVAEATLAAAWDAGIRYFDTAPEYGPGISEHRFGHVLRNRPRD
EFVLSTKVGRLLRADSSKGGKHGPFVKGLPFRVDYDYTADGVRRSIEDSLQRLGMARIDI
AYIHDCAEDAHGDRWLEVFDTAMKGAAVALTQLREEGVIRAWGLGVNRVEPCVMAMERAD
PDVFLLAGRYSLLNQPALDTLFPRCQERGVHVVVGGPYNSGLIAGGKTFEYQEAPPDKVA
ARDRLAEIAKRHGVDLRAAALQFCAAHPVVASVIPGTKNPPRVQENMALMKQPIPADFWR
ELKQAGVLPEQVPTPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory