Comparing AZOBR_RS24680 FitnessBrowser__azobra:AZOBR_RS24680 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
I6Y3T7 17-hydroxy-3-oxo-4-pregnene-20-carboxyl-CoA lyase; Retro-aldolase Ltp2; EC 4.1.3.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 91% coverage: 3:355/387 of query aligns to 2:358/386 of I6Y3T7
D1AB74 Steroid side-chain-cleaving aldolase; 3-oxo-23,24-bisnorchol-4-en-17-ol-22-oyl-CoA lyase; EC 4.1.3.- from Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9) (see paper)
38% identity, 85% coverage: 28:355/387 of query aligns to 27:360/391 of D1AB74
7pytD Benzoylsuccinyl-coa thiolase with coenzyme a (see paper)
35% identity, 65% coverage: 132:382/387 of query aligns to 125:382/392 of 7pytD
Sites not aligning to the query:
7pytB Benzoylsuccinyl-coa thiolase with coenzyme a (see paper)
35% identity, 65% coverage: 132:382/387 of query aligns to 125:382/392 of 7pytB
Sites not aligning to the query:
6hsjB Crystal structure of the zebrafish peroxisomal scp2-thiolase (type-1) in complex with coa (see paper)
28% identity, 88% coverage: 36:374/387 of query aligns to 34:375/390 of 6hsjB
Sites not aligning to the query:
6hspB Crystal structure of the zebrafish peroxisomal scp2-thiolase (type-1) in complex with coa and octanoyl-coa (see paper)
32% identity, 60% coverage: 141:374/387 of query aligns to 137:374/389 of 6hspB
Sites not aligning to the query:
4yzoC Crystal structure analysis of thiolase-like protein, st0096 from sulfolobus tokodaii
34% identity, 62% coverage: 145:385/387 of query aligns to 106:342/347 of 4yzoC
Sites not aligning to the query:
P22307 Sterol carrier protein 2; SCP-2; Acetyl-CoA C-myristoyltransferase; Non-specific lipid-transfer protein; NSL-TP; Propanoyl-CoA C-acyltransferase; SCP-2/3-oxoacyl-CoA thiolase; SCP-2/thiolase; SCP-chi; SCPX; Sterol carrier protein X; SCP-X; EC 2.3.1.155; EC 2.3.1.176; EC 2.3.1.16 from Homo sapiens (Human) (see 2 papers)
30% identity, 60% coverage: 142:374/387 of query aligns to 157:393/547 of P22307
Sites not aligning to the query:
6esqA Structure of the acetoacetyl-coa thiolase/hmg-coa synthase complex from methanothermococcus thermolithotrophicus soaked with acetyl-coa (see paper)
28% identity, 63% coverage: 131:374/387 of query aligns to 125:371/392 of 6esqA
G5EDP2 Non-specific lipid-transfer protein-like 2; NSL-TP2; 3-keto-acyl-CoA thiolase; Abnormal dauer formation protein 22; Propanoyl-CoA C-acyltransferase; Protein P-44; EC 2.3.1.176 from Caenorhabditis elegans (see 2 papers)
28% identity, 60% coverage: 139:372/387 of query aligns to 147:388/412 of G5EDP2
5mg5L A multi-component acyltransferase phlabc from pseudomonas protegens soaked with the monoacetylphloroglucinol (mapg) (see paper)
24% identity, 99% coverage: 6:387/387 of query aligns to 3:395/396 of 5mg5L
5lotA Crystal structure of scp2 thiolase from leishmania mexicana. Complex of the c123a mutant with acetyl-coa. (see paper)
29% identity, 60% coverage: 153:385/387 of query aligns to 174:427/430 of 5lotA
Sites not aligning to the query:
5lnqA Crystal structure of scp2 thiolase from leishmania mexicana. Complex of the c123a mutant with acetoacetyl-coa. (see paper)
29% identity, 60% coverage: 153:385/387 of query aligns to 174:427/430 of 5lnqA
Sites not aligning to the query:
3zbnA Crystal structure of scp2 thiolase from leishmania mexicana. Complex of the c123a mutant with coenzyme a. (see paper)
29% identity, 60% coverage: 153:385/387 of query aligns to 174:427/430 of 3zbnA
Sites not aligning to the query:
5ab6D Crystal structure of trypanosoma brucei scp2-thiolase like protein (tbslp) in complex with acetoacetyl-coa. (see paper)
29% identity, 90% coverage: 36:385/387 of query aligns to 32:393/396 of 5ab6D
5ab7A Crystal structure of trypanosoma brucei scp2-thiolase like protein (tbslp) in complex with malonyl-coa. (see paper)
27% identity, 90% coverage: 36:385/387 of query aligns to 32:388/392 of 5ab7A
Q4WCL5 Acetyl-CoA acetyltransferase erg10B, cytosolic; Acetoacetyl-CoA thiolase erg10B; ACAT; Cytosolic thiolase erg10B; CT; Ergosterol biosynthesis protein 10B; EC 2.3.1.9 from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata)
29% identity, 37% coverage: 215:356/387 of query aligns to 255:377/398 of Q4WCL5
Sites not aligning to the query:
6aqpA Aspergillus fumigatus cytosolic thiolase: acetylated enzyme in complex with coa and potassium ions
29% identity, 37% coverage: 215:356/387 of query aligns to 254:376/397 of 6aqpA
Sites not aligning to the query:
6aqpC Aspergillus fumigatus cytosolic thiolase: acetylated enzyme in complex with coa and potassium ions
29% identity, 37% coverage: 215:356/387 of query aligns to 256:378/399 of 6aqpC
Sites not aligning to the query:
6bn2A Crystal structure of acetyl-coa acetyltransferase from elizabethkingia anophelis nuhp1
27% identity, 37% coverage: 211:352/387 of query aligns to 245:367/393 of 6bn2A
Sites not aligning to the query:
>AZOBR_RS24680 FitnessBrowser__azobra:AZOBR_RS24680
IDLSGKAAIAGVFESPRRDAPRVHPFALQMECILGALDDAGLTLKDVDGLCAASGDWAEG
GSTMDVVELAEYIGIAPTYVNSTDVGGCSYILQAGQAAAAIATGLAEVVVISYAACPRWW
PLSSPSFDPFVFPAGPGQYEIPYAPTLISTYGLFARRHMDLYGTTPEQLAQVAVTFREHA
AKNPDARLRKPITVDDVLASPMIASPLHRLDCCVVTDGGGAVVMTSRERARDLKKPPVHV
VGYGAAVARTQNSQIPDDLTTPAALSGPRAFAMAGVTPGEIDVAQIYDAFTITPMLALED
LGFCGRGESGAFVADGNLTLGGSLPTNTDGGGLSSNHPGKRGIFTLIESVRQLRGEGPGV
QVPDARIALAHGLGGTFCSAATAILAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory