SitesBLAST
Comparing AZOBR_RS24695 FitnessBrowser__azobra:AZOBR_RS24695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
47% identity, 96% coverage: 6:250/256 of query aligns to 1:244/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G20), R18 (≠ G23), G19 (= G24), I20 (= I25), D39 (= D44), R40 (≠ I45), C63 (≠ L69), I65 (≠ V71), N91 (≠ V97), G93 (= G99), I94 (= I100), V114 (= V120), Y155 (= Y161), K159 (= K165), I188 (≠ V194), T190 (= T196), T193 (≠ V199)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
44% identity, 94% coverage: 10:250/256 of query aligns to 5:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), S17 (≠ G22), R18 (≠ G23), I20 (= I25), T40 (≠ V49), N62 (= N70), V63 (= V71), N89 (≠ V97), A90 (= A98), I92 (= I100), V139 (≠ I147), S141 (= S149), Y154 (= Y161), K158 (= K165), P184 (= P191), G185 (= G192), I187 (≠ V194), T189 (= T196), M191 (≠ I198)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
44% identity, 93% coverage: 14:250/256 of query aligns to 5:243/246 of 3osuA
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
45% identity, 94% coverage: 11:250/256 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G24), S142 (= S149), Q152 (= Q158), Y155 (= Y161), K159 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (≠ G22), R15 (≠ G23), G16 (= G24), I17 (= I25), N35 (≠ A43), Y36 (≠ D44), N37 (≠ I45), G38 (= G46), S39 (≠ A47), N63 (= N70), V64 (= V71), N90 (≠ V97), A91 (= A98), I93 (= I100), I113 (≠ V120), S142 (= S149), Y155 (= Y161), K159 (= K165), P185 (= P191), I188 (≠ V194), T190 (= T196)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
42% identity, 95% coverage: 7:250/256 of query aligns to 1:241/244 of 4nbuB
- active site: G18 (= G24), N111 (= N121), S139 (= S149), Q149 (= Q158), Y152 (= Y161), K156 (= K165)
- binding acetoacetyl-coenzyme a: D93 (= D103), K98 (= K108), S139 (= S149), N146 (≠ T155), V147 (≠ F156), Q149 (= Q158), Y152 (= Y161), F184 (≠ V193), M189 (≠ I198), K200 (≠ Q209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G20), N17 (≠ G23), G18 (= G24), I19 (= I25), D38 (= D44), F39 (≠ I45), V59 (≠ L69), D60 (≠ N70), V61 (= V71), N87 (≠ V97), A88 (= A98), G89 (= G99), I90 (= I100), T137 (≠ I147), S139 (= S149), Y152 (= Y161), K156 (= K165), P182 (= P191), F184 (≠ V193), T185 (≠ V194), T187 (= T196), M189 (≠ I198)
5vt6A Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b complexed with NADP
45% identity, 93% coverage: 14:250/256 of query aligns to 2:241/245 of 5vt6A
- active site: G12 (= G24), D102 (≠ E113), S138 (= S149), Y151 (= Y161), K155 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), G11 (= G23), G12 (= G24), L13 (≠ I25), H32 (≠ D44), S33 (≠ A47), N36 (≠ A50), V58 (≠ L69), D59 (≠ N70), V60 (= V71), N86 (≠ V97), A87 (= A98), G88 (= G99), I89 (= I100), I136 (= I147), Y151 (= Y161), K155 (= K165), P181 (= P191), Y183 (≠ V193), L184 (≠ V194), T186 (= T196)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
44% identity, 94% coverage: 10:250/256 of query aligns to 5:239/243 of 4i08A
- active site: G19 (= G24), N113 (= N121), S141 (= S149), Q151 (= Q158), Y154 (= Y161), K158 (= K165)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), S17 (≠ G22), R18 (≠ G23), I20 (= I25), T40 (≠ V49), N62 (= N70), V63 (= V71), N89 (≠ V97), A90 (= A98), G140 (≠ A148), S141 (= S149), Y154 (= Y161), K158 (= K165), P184 (= P191), G185 (= G192), T189 (= T196)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
44% identity, 93% coverage: 14:250/256 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G24), S138 (= S149), Q148 (= Q158), Y151 (= Y161), K155 (= K165)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), S10 (≠ G22), R11 (≠ G23), I13 (= I25), N31 (≠ A43), Y32 (≠ D44), A33 (≠ I45), G34 (= G46), S35 (≠ A47), A58 (≠ L69), N59 (= N70), V60 (= V71), N86 (≠ V97), A87 (= A98), T109 (≠ V120), S138 (= S149), Y151 (= Y161), K155 (= K165), P181 (= P191), G182 (= G192)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
43% identity, 95% coverage: 9:250/256 of query aligns to 1:236/239 of 4nbtA
- active site: G16 (= G24), S132 (= S149), Y145 (= Y161), K149 (= K165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), K15 (≠ G23), G16 (= G24), L17 (≠ I25), D36 (= D44), L37 (≠ I45), L52 (= L69), N53 (= N70), V54 (= V71), N80 (≠ V97), A81 (= A98), G82 (= G99), I130 (= I147), S132 (= S149), Y145 (= Y161), K149 (= K165), P177 (= P191), G178 (= G192), I180 (≠ V194), T182 (= T196)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
43% identity, 94% coverage: 11:250/256 of query aligns to 3:240/244 of 6t77A
- active site: G16 (= G24), S138 (= S149), Y151 (= Y161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (≠ G22), R15 (≠ G23), T37 (≠ V49), L58 (= L69), N59 (= N70), V60 (= V71), A87 (= A98), G88 (= G99), I89 (= I100)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
40% identity, 94% coverage: 11:250/256 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G20), M16 (≠ I25), D35 (= D44), I36 (= I45), I62 (≠ V71), N88 (≠ V97), G90 (= G99), I138 (= I147), S140 (= S149), Y152 (= Y161), K156 (= K165), I185 (≠ V194)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
40% identity, 94% coverage: 11:250/256 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ G23) binding
- D36 (= D44) binding
- D62 (≠ N70) binding
- I63 (≠ V71) binding
- N89 (≠ V97) binding
- Y153 (= Y161) binding
- K157 (= K165) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
43% identity, 94% coverage: 11:250/256 of query aligns to 3:240/244 of P0AEK2
- GASR 12:15 (≠ GGGG 20:23) binding
- T37 (≠ V49) binding
- NV 59:60 (= NV 70:71) binding
- N86 (≠ V97) binding
- Y151 (= Y161) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSASK 161:165) binding
- A154 (≠ S164) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K165) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ V194) binding
- E233 (≠ Q243) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
43% identity, 94% coverage: 11:250/256 of query aligns to 2:239/243 of 1q7bA
- active site: G15 (= G24), E101 (= E113), S137 (= S149), Q147 (= Q158), Y150 (= Y161), K154 (= K165)
- binding calcium ion: E232 (≠ Q243), T233 (= T244)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G20), S13 (≠ G22), R14 (≠ G23), T36 (≠ V49), N58 (= N70), V59 (= V71), N85 (≠ V97), A86 (= A98), G87 (= G99), I88 (= I100), S137 (= S149), Y150 (= Y161), K154 (= K165), P180 (= P191), G181 (= G192), I183 (≠ V194)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
43% identity, 94% coverage: 11:250/256 of query aligns to 2:239/243 of 1q7cA
- active site: G15 (= G24), S137 (= S149), Q147 (= Q158), F150 (≠ Y161), K154 (= K165)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G20), S13 (≠ G22), R14 (≠ G23), A35 (≠ E48), T36 (≠ V49), L57 (= L69), N58 (= N70), V59 (= V71), G87 (= G99), I88 (= I100)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 94% coverage: 11:250/256 of query aligns to 3:240/244 of P0A2C9
- M125 (≠ V136) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A233) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S234) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
43% identity, 93% coverage: 14:250/256 of query aligns to 2:241/245 of 4k6fB
- active site: G12 (= G24), N102 (≠ E113), S138 (= S149), Y151 (= Y161), K155 (= K165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), Y32 (≠ D44), S33 (≠ I45), N36 (≠ E48), V58 (≠ L69), D59 (≠ N70), V60 (= V71), A87 (= A98), G88 (= G99), I89 (= I100)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
43% identity, 94% coverage: 11:250/256 of query aligns to 10:250/254 of 4ag3A
- active site: G23 (= G24), S148 (= S149), Y161 (= Y161), K165 (= K165)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G20), S21 (≠ G22), R22 (≠ G23), G23 (= G24), I24 (= I25), T44 (≠ I45), L68 (= L69), D69 (≠ N70), V70 (= V71), N96 (≠ V97), A97 (= A98), I146 (= I147), S148 (= S149), Y161 (= Y161), K165 (= K165), P191 (= P191), G192 (= G192), F193 (≠ V193), I194 (≠ V194), T196 (= T196), M198 (≠ I198), T199 (≠ V199)
Q9L9F8 Short-chain reductase protein NovJ; Novobiocin biosynthesis protein J; EC 1.1.1.- from Streptomyces niveus (Streptomyces spheroides) (see paper)
44% identity, 92% coverage: 15:250/256 of query aligns to 18:260/262 of Q9L9F8
- S152 (= S149) mutation to A: 2-3-fold decrease in beta-ketotyrosine product formation.
- Y164 (= Y161) mutation to F: 50-fold reduction in catalytic activity.
- K168 (= K165) mutation to I: Does not alter the catalytic turnover.
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
42% identity, 95% coverage: 9:250/256 of query aligns to 4:248/251 of 4cqlI
- active site: G19 (= G24), S146 (= S149), Y159 (= Y161), K163 (= K165)
- binding nicotinamide-adenine-dinucleotide: S18 (≠ G23), G19 (= G24), I20 (= I25), D39 (= D44), L40 (≠ I45), A64 (≠ L69), D65 (≠ N70), V66 (= V71), C93 (≠ V97), A94 (= A98), G95 (= G99), I96 (= I100), V116 (= V120), I144 (= I147), S146 (= S149), Y159 (= Y161), K163 (= K165), P189 (= P191), G190 (= G192), I192 (≠ V194), T194 (= T196), M196 (≠ I198)
Query Sequence
>AZOBR_RS24695 FitnessBrowser__azobra:AZOBR_RS24695
MSAPTTHPRRLAGRVAFVTGGGGGIGRAVCERLAAEGAAVVVADIGAEVAETVAAALRAE
GAQAHATALNVADRESWGAAVTGLPEAFRGVDIMVNVAGIVRDRSLPKMTDAEWSAVIDV
NLRGTWLGCQTAFRLVGDRGWGRIVNIASTAILGTFGQANYSASKAGVVGLTRTAALEGA
RRGILVNAVAPGVVETAIVEGVPDAVRSQWLEKTPIGRLGKPAEIAAVVAFLASDDAAYV
TGQTIVADGGATTGDY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory