Comparing AZOBR_RS25220 FitnessBrowser__azobra:AZOBR_RS25220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
8wm8B Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with nitrate (see paper)
32% identity, 56% coverage: 91:232/252 of query aligns to 107:251/265 of 8wm8B
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
29% identity, 67% coverage: 84:251/252 of query aligns to 45:212/506 of A0A0H2ZQB9
Sites not aligning to the query:
>AZOBR_RS25220 FitnessBrowser__azobra:AZOBR_RS25220
LGRAALYVALPVALLAAWQAAFALGYIRPILLPPPTRVGKAFVDLAASGDLFRHLGVSLL
RVLEGFAIAALVGLPLGIGIGLSRTLDRLTDLIIQLTKPIPPIAWIPLAILWFGIGEAGK
VYIIFLGAIFPILVNTIDGNRQTDHRHVELARVLEVTRRRFILQVVLPGALPNIMTGLRV
GLMVAWICVVAAELIAASSGLGYLIMDARQMSQTDQVLVGMITIGAMGKLLDVVLRAAER
RLITWKTTFSGS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory