SitesBLAST
Comparing AZOBR_RS25335 FitnessBrowser__azobra:AZOBR_RS25335 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 95% coverage: 2:347/365 of query aligns to 9:364/378 of P69874
- C26 (≠ Y19) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ G20) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ L38) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C47) mutation to T: Loss of ATPase activity and transport.
- L60 (= L53) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ V69) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V128) mutation to M: Loss of ATPase activity and transport.
- D172 (= D165) mutation to N: Loss of ATPase activity and transport.
- C276 (≠ G261) mutation to A: Lower ATPase activity and transport efficiency.
- E297 (≠ H282) mutation E->K,D: Lower ATPase activity and transport efficiency.; mutation to Q: Loss of ATPase activity and transport.
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
39% identity, 96% coverage: 7:355/365 of query aligns to 4:366/375 of 2d62A
1g291 Malk (see paper)
52% identity, 60% coverage: 25:242/365 of query aligns to 18:241/372 of 1g291
- binding magnesium ion: D69 (vs. gap), E71 (vs. gap), K72 (vs. gap), K79 (≠ H80), D80 (≠ A81)
- binding pyrophosphate 2-: S38 (= S45), G39 (= G46), C40 (= C47), G41 (= G48), K42 (= K49), T43 (= T50), T44 (= T51)
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
41% identity, 95% coverage: 10:357/365 of query aligns to 3:354/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (= Y19), S38 (= S45), G39 (= G46), G41 (= G48), K42 (= K49), S43 (≠ T50), Q82 (= Q89), Q133 (≠ A140), G136 (= G143), G137 (= G144), Q138 (= Q145), H192 (= H199)
- binding magnesium ion: S43 (≠ T50), Q82 (= Q89)
8hprD Lpqy-sugabc in state 4 (see paper)
41% identity, 95% coverage: 10:357/365 of query aligns to 3:353/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (= Y19), S38 (= S45), C40 (= C47), G41 (= G48), K42 (= K49), S43 (≠ T50), T44 (= T51), Q82 (= Q89), R129 (= R136), Q133 (≠ A140), S135 (= S142), G136 (= G143), G137 (= G144), Q159 (≠ E166), H192 (= H199)
- binding magnesium ion: S43 (≠ T50), Q82 (= Q89)
8hplC Lpqy-sugabc in state 1 (see paper)
45% identity, 76% coverage: 10:287/365 of query aligns to 3:278/384 of 8hplC
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 68% coverage: 7:255/365 of query aligns to 1:251/393 of P9WQI3
- H193 (= H199) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
49% identity, 65% coverage: 7:242/365 of query aligns to 4:230/353 of 1vciA
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
45% identity, 66% coverage: 10:250/365 of query aligns to 1:242/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y19), S35 (= S45), G36 (= G46), C37 (= C47), G38 (= G48), K39 (= K49), S40 (≠ T50), T41 (= T51), R126 (= R136), A130 (= A140), S132 (= S142), G134 (= G144), Q135 (= Q145)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
45% identity, 66% coverage: 10:250/365 of query aligns to 3:244/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
45% identity, 66% coverage: 10:250/365 of query aligns to 4:245/371 of P68187
- A85 (= A92) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ P113) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ T121) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A124) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A126) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ S131) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G144) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D165) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ G235) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- F241 (≠ R246) mutation to I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
45% identity, 66% coverage: 10:250/365 of query aligns to 3:244/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y19), S37 (= S45), G38 (= G46), C39 (= C47), G40 (= G48), K41 (= K49), S42 (≠ T50), T43 (= T51), Q81 (= Q89), R128 (= R136), A132 (= A140), S134 (= S142), G136 (= G144), Q137 (= Q145), E158 (= E166), H191 (= H199)
- binding magnesium ion: S42 (≠ T50), Q81 (= Q89)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
45% identity, 66% coverage: 10:250/365 of query aligns to 3:244/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y19), G38 (= G46), C39 (= C47), G40 (= G48), K41 (= K49), S42 (≠ T50), T43 (= T51), R128 (= R136), S134 (= S142), Q137 (= Q145)
- binding beryllium trifluoride ion: S37 (= S45), G38 (= G46), K41 (= K49), Q81 (= Q89), S134 (= S142), G136 (= G144), H191 (= H199)
- binding magnesium ion: S42 (≠ T50), Q81 (= Q89)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
45% identity, 66% coverage: 10:250/365 of query aligns to 3:244/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y19), V17 (≠ P24), G38 (= G46), C39 (= C47), G40 (= G48), K41 (= K49), S42 (≠ T50), T43 (= T51), R128 (= R136), A132 (= A140), S134 (= S142), Q137 (= Q145)
- binding tetrafluoroaluminate ion: S37 (= S45), G38 (= G46), K41 (= K49), Q81 (= Q89), S134 (= S142), G135 (= G143), G136 (= G144), E158 (= E166), H191 (= H199)
- binding magnesium ion: S42 (≠ T50), Q81 (= Q89)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
45% identity, 66% coverage: 10:250/365 of query aligns to 3:244/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y19), V17 (≠ P24), G38 (= G46), C39 (= C47), G40 (= G48), K41 (= K49), S42 (≠ T50), T43 (= T51), R128 (= R136), A132 (= A140), S134 (= S142), Q137 (= Q145)
- binding magnesium ion: S42 (≠ T50), Q81 (= Q89)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
47% identity, 61% coverage: 29:250/365 of query aligns to 22:245/369 of P19566
- L86 (= L93) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P167) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D172) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
3d31A Modbc from methanosarcina acetivorans (see paper)
39% identity, 80% coverage: 10:301/365 of query aligns to 2:293/348 of 3d31A
Sites not aligning to the query:
2awnC Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
46% identity, 61% coverage: 29:250/365 of query aligns to 14:214/344 of 2awnC
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
43% identity, 64% coverage: 25:258/365 of query aligns to 20:262/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
43% identity, 64% coverage: 25:258/365 of query aligns to 20:262/353 of 1oxvA
Sites not aligning to the query:
Query Sequence
>AZOBR_RS25335 FitnessBrowser__azobra:AZOBR_RS25335
MSAPQTLVPLALDRLAKRYGTAPPALAALSLEVAGGELLGLVGPSGCGKTTALRLIAGLT
PASGGRVLVGGRDITALPAHARGIGLVFQNYALFPHMTAADNVAFGLRMRGLPAAERHAR
TAEALAMVRLSHLGGRKPRALSGGQQQRVALARALAIRPNLLLLDEPLSNLDAGLRAELL
AEIRTLQRRLGITALFVTHDQGEALAVCDRIAVLRDGRLEQVGTPREVHDRPASGFVAGF
VGRTNRIPAERLAGGALRVGGTLLPALADGPAGPVDLFVRPHRIRVGAAGGAGGLPAVLR
GTAFLGDRIALSLEAGGAPVTVDWPVEAAPPAPGPALTPGETVALSWDPADMAVFAATRP
ADAPP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory