Comparing AZOBR_RS25405 FitnessBrowser__azobra:AZOBR_RS25405 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
57% identity, 91% coverage: 31:343/345 of query aligns to 1:313/314 of 4p8bA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
34% identity, 83% coverage: 50:334/345 of query aligns to 19:294/303 of 4pddA
Sites not aligning to the query:
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
31% identity, 87% coverage: 46:344/345 of query aligns to 19:310/310 of 7bbrA
Sites not aligning to the query:
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
31% identity, 87% coverage: 46:344/345 of query aligns to 18:309/310 of 7bcrA
Sites not aligning to the query:
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
31% identity, 87% coverage: 46:344/345 of query aligns to 18:309/310 of 7bcpA
Sites not aligning to the query:
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
31% identity, 87% coverage: 46:344/345 of query aligns to 18:309/310 of 7bcoA
Sites not aligning to the query:
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
31% identity, 87% coverage: 46:344/345 of query aligns to 18:309/310 of 7bcnA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
34% identity, 85% coverage: 46:339/345 of query aligns to 17:302/304 of 4x8rA
Sites not aligning to the query:
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
34% identity, 81% coverage: 46:325/345 of query aligns to 13:283/300 of 4pf8A
Sites not aligning to the query:
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
32% identity, 79% coverage: 54:327/345 of query aligns to 22:286/303 of 4p3lA
Sites not aligning to the query:
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
35% identity, 79% coverage: 51:321/345 of query aligns to 20:280/304 of 4xeqB
Sites not aligning to the query:
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
33% identity, 82% coverage: 54:336/345 of query aligns to 23:296/301 of 4pdhA
Sites not aligning to the query:
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
31% identity, 91% coverage: 29:343/345 of query aligns to 5:310/312 of 4oanA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
32% identity, 80% coverage: 54:330/345 of query aligns to 26:293/304 of 4pakA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
32% identity, 80% coverage: 54:330/345 of query aligns to 25:292/303 of 4p9kA
Sites not aligning to the query:
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
32% identity, 76% coverage: 64:325/345 of query aligns to 32:284/300 of 4n8yA
Sites not aligning to the query:
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
29% identity, 94% coverage: 4:328/345 of query aligns to 7:314/328 of Q0B2F6
4n8gA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0660), target efi-501075, with bound d-alanine-d-alanine (see paper)
33% identity, 80% coverage: 57:332/345 of query aligns to 29:299/325 of 4n8gA
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
30% identity, 77% coverage: 62:328/345 of query aligns to 30:288/301 of 4n17A
Sites not aligning to the query:
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
30% identity, 77% coverage: 62:328/345 of query aligns to 30:288/301 of 4n15A
Sites not aligning to the query:
>AZOBR_RS25405 FitnessBrowser__azobra:AZOBR_RS25405
MLTRTRPLLAAALTLFGALAVLSAPAEAAEYKSEYKLSVVGSRPIPIAEGAYRWAELVTE
KTRGRITVKVYPGSSLVGGDNTREFTGLRQGSIDLLVNSTINLSPTVKEANLFSLPFLFP
DSKAFDAVAQGEPGKALFGILESKQVVPLAVGENGFRALSNSKKPVRTPDDLKGLKVRVV
GSPIFNDIFTALGANPTQMTFADLQPALSTGAVDGQENPVSLFLAAKLYGLNQKHLTLWN
YIADAGLFIANKEVWESWTPEDRALVREAAVQAAAEFTALSRQGLTAEDRSALTALASHG
VQVVTTEQTDVEAFRKATRPVYEKWTQTVGADLVRKAEEAVAKSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory