SitesBLAST
Comparing AZOBR_RS25420 FitnessBrowser__azobra:AZOBR_RS25420 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5jc8D Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
49% identity, 97% coverage: 6:263/267 of query aligns to 1:258/262 of 5jc8D
7krmC Putative fabg bound to nadh from acinetobacter baumannii
42% identity, 95% coverage: 9:262/267 of query aligns to 3:241/244 of 7krmC
- active site: G18 (= G27), S140 (= S152), Y155 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), S15 (= S21), G18 (= G27), I19 (≠ N28), D38 (= D47), L39 (≠ V49), A60 (= A72), N61 (≠ D73), V62 (= V74), N88 (= N100), V111 (≠ T123), S140 (= S152), Y155 (= Y165), K159 (= K169), I188 (= I198), T190 (= T200)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
40% identity, 96% coverage: 9:264/267 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G27), S142 (= S152), Q152 (≠ Y162), Y155 (= Y165), K159 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (= S21), R15 (≠ S22), G16 (= G27), I17 (≠ N28), N35 (≠ A45), Y36 (≠ V46), N37 (≠ D47), G38 (≠ K48), S39 (≠ V49), N63 (≠ D73), V64 (= V74), N90 (= N100), A91 (≠ V101), I93 (= I103), I113 (≠ T123), S142 (= S152), Y155 (= Y165), K159 (= K169), P185 (= P195), I188 (= I198), T190 (= T200)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
34% identity, 96% coverage: 9:263/267 of query aligns to 5:251/261 of P40288
- 11:35 (vs. 15:44, 33% identical) binding
- E96 (≠ T104) mutation E->A,G,K: Heat stable.
- D108 (≠ S116) mutation to N: Heat stable.
- V112 (= V120) mutation to A: Heat stable.
- E133 (≠ A141) mutation to K: Heat stable.
- V183 (≠ A190) mutation to I: Heat stable.
- P194 (= P201) mutation to Q: Heat stable.
- E210 (≠ D222) mutation to K: Heat stable.
- Y217 (≠ F229) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
34% identity, 96% coverage: 9:263/267 of query aligns to 5:251/261 of 1g6kA
- active site: G18 (= G27), S145 (= S152), Y158 (= Y165), K162 (= K169)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S21), G18 (= G27), L19 (≠ N28), R39 (≠ V49), D65 (= D73), V66 (= V74), N92 (= N100), A93 (≠ V101), G94 (= G102), M143 (≠ I150), S145 (= S152), Y158 (= Y165), P188 (= P195), G189 (= G196), I191 (= I198), T193 (= T200)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
37% identity, 96% coverage: 9:263/267 of query aligns to 5:259/261 of 6zzsD
- active site: G18 (= G27), S143 (= S152), Y156 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G14 (= G18), S17 (= S21), I19 (≠ N28), D38 (= D47), M39 (≠ K48), D64 (= D73), V65 (= V74), N91 (= N100), A92 (≠ V101), G93 (= G102), M141 (≠ I150), A142 (≠ S151), S143 (= S152), Y156 (= Y165), K160 (= K169), P186 (= P195), G187 (= G196), V189 (≠ I198), T191 (= T200), L193 (≠ M202)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ T104), S143 (= S152), N145 (≠ A154), K153 (≠ Y162), Y156 (= Y165), Q197 (= Q206)
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
36% identity, 96% coverage: 9:264/267 of query aligns to 5:253/254 of 4fn4A
- active site: G18 (= G27), S144 (= S152), Y157 (= Y165), K161 (= K169), S202 (≠ D213)
- binding nicotinamide-adenine-dinucleotide: G14 (= G18), S17 (= S21), G18 (= G27), I19 (≠ N28), E38 (≠ D47), L39 (≠ K48), R43 (≠ A52), A63 (= A72), D64 (= D73), V65 (= V74), N91 (= N100), G93 (= G102), I94 (= I103), T142 (≠ I150), S144 (= S152), Y157 (= Y165), K161 (= K169), P187 (= P195), V190 (≠ I198), T192 (= T200), N193 (≠ P201), I194 (≠ M202)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
37% identity, 96% coverage: 9:263/267 of query aligns to 4:258/260 of 6zzqA
- active site: G17 (= G27), S142 (= S152), Y155 (= Y165)
- binding acetoacetic acid: Q94 (≠ T104), S142 (= S152), K152 (≠ Y162), Y155 (= Y165), Q196 (= Q206)
- binding nicotinamide-adenine-dinucleotide: G13 (= G18), S16 (= S21), G17 (= G27), I18 (≠ N28), D37 (= D47), M38 (≠ K48), D63 (= D73), V64 (= V74), N90 (= N100), A91 (≠ V101), G92 (= G102), M140 (≠ I150), A141 (≠ S151), S142 (= S152), Y155 (= Y165), K159 (= K169), Y187 (≠ L197), V188 (≠ I198), T190 (= T200)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
37% identity, 96% coverage: 7:263/267 of query aligns to 1:246/248 of 6ixmC
- active site: G16 (= G27), S142 (= S152), Y155 (= Y165), K159 (= K169)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), S15 (= S21), G16 (= G27), I17 (≠ N28), D36 (= D47), I37 (≠ K48), A61 (= A72), D62 (= D73), T63 (≠ V74), N89 (= N100), A90 (≠ V101), M140 (≠ I150), S142 (= S152), Y155 (= Y165), K159 (= K169), P185 (= P195), A186 (≠ G196), Y187 (≠ L197), I188 (= I198), L192 (≠ M202)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
40% identity, 93% coverage: 12:260/267 of query aligns to 3:245/250 of 2cfcA
- active site: G13 (= G27), S142 (= S152), Y155 (= Y165), K159 (= K169)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ Y160), R152 (≠ Y162), Y155 (= Y165), W195 (≠ S205), R196 (≠ Q206)
- binding nicotinamide-adenine-dinucleotide: G9 (= G18), S12 (= S21), G13 (= G27), N14 (= N28), D33 (= D47), L34 (≠ K48), A59 (= A72), D60 (= D73), V61 (= V74), N87 (= N100), A88 (≠ V101), G89 (= G102), I140 (= I150), P185 (= P195), G186 (= G196), M187 (≠ L197), I188 (= I198), T190 (= T200), P191 (= P201), M192 (= M202), T193 (≠ A203)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
40% identity, 93% coverage: 12:260/267 of query aligns to 3:245/250 of Q56840
- S-----GN 12:14 (≠ SSAPGWGN 21:28) binding
- D33 (= D47) binding
- DV 60:61 (= DV 73:74) binding
- N87 (= N100) binding
- S142 (= S152) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ Y162) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y165) mutation Y->E,F: Loss of activity.
- K159 (= K169) mutation to A: Loss of activity.
- R179 (= R189) mutation to A: Loss of activity.
- IETPM 188:192 (≠ IDTPM 198:202) binding
- WR 195:196 (≠ SQ 205:206) binding
- R196 (≠ Q206) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (= R218) mutation to A: Slight decrease in catalytic efficiency.
- R209 (≠ L224) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 95% coverage: 12:264/267 of query aligns to 5:246/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 95% coverage: 12:264/267 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G27), S138 (= S152), Q148 (≠ Y162), Y151 (= Y165), K155 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), S10 (≠ G20), R11 (≠ S21), I13 (≠ N28), N31 (≠ A45), Y32 (≠ V46), A33 (≠ D47), G34 (≠ K48), S35 (≠ V49), A58 (= A72), N59 (≠ D73), V60 (= V74), N86 (= N100), A87 (≠ V101), T109 (= T123), S138 (= S152), Y151 (= Y165), K155 (= K169), P181 (= P195), G182 (= G196)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
38% identity, 96% coverage: 8:263/267 of query aligns to 10:264/267 of Q9LBG2
- 17:42 (vs. 15:45, 45% identical) binding
- E103 (≠ T104) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
38% identity, 96% coverage: 8:263/267 of query aligns to 1:255/258 of 1iy8A
- active site: G15 (= G27), S143 (= S152), Q153 (≠ Y162), Y156 (= Y165), K160 (= K169)
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), S14 (= S21), G15 (= G27), L16 (≠ N28), D35 (= D47), V36 (≠ K48), A62 (= A72), D63 (= D73), V64 (= V74), N90 (= N100), G92 (= G102), I93 (= I103), T141 (≠ I150), S143 (= S152), Y156 (= Y165), K160 (= K169), P186 (= P195), G187 (= G196), T191 (= T200), P192 (= P201), M193 (= M202)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
32% identity, 96% coverage: 9:263/267 of query aligns to 11:257/267 of 3ay6B
- active site: G24 (= G27), S151 (= S152), Y164 (= Y165), K168 (= K169)
- binding beta-D-glucopyranose: E102 (≠ T104), S151 (= S152), H153 (vs. gap), W158 (= W158), Y164 (= Y165), N202 (≠ A203), K205 (≠ Q206)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G18), T23 (≠ S21), G24 (= G27), L25 (≠ N28), Y45 (≠ A52), D71 (= D73), V72 (= V74), N98 (= N100), A99 (≠ V101), G100 (= G102), V101 (≠ I103), M149 (≠ I150), S151 (= S152), Y164 (= Y165), K168 (= K169), P194 (= P195), G195 (= G196), M197 (≠ I198), T199 (= T200), P200 (= P201), I201 (≠ M202), N202 (≠ A203)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
38% identity, 96% coverage: 9:264/267 of query aligns to 10:253/254 of 4ag3A
- active site: G23 (= G27), S148 (= S152), Y161 (= Y165), K165 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), S21 (≠ G20), R22 (≠ S21), G23 (= G27), I24 (≠ N28), T44 (≠ K48), L68 (≠ A72), D69 (= D73), V70 (= V74), N96 (= N100), A97 (≠ V101), I146 (= I150), S148 (= S152), Y161 (= Y165), K165 (= K169), P191 (= P195), G192 (= G196), F193 (≠ L197), I194 (= I198), T196 (= T200), M198 (= M202), T199 (≠ A203)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
41% identity, 95% coverage: 9:261/267 of query aligns to 3:247/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), G16 (= G27), I17 (≠ N28), D36 (= D47), L37 (≠ K48), C61 (≠ A72), D62 (= D73), V63 (= V74), N89 (= N100), A90 (≠ V101), T140 (≠ I150), S142 (= S152), Y155 (= Y165), K159 (= K169), A186 (≠ G196), V187 (≠ L197)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
40% identity, 96% coverage: 9:264/267 of query aligns to 4:246/247 of P73574
- A14 (= A19) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ Y160) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K169) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ L197) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ I207) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
38% identity, 96% coverage: 8:264/267 of query aligns to 5:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G18), S17 (≠ G20), R18 (≠ S21), I20 (≠ N28), T40 (≠ K48), N62 (≠ A69), V63 (= V70), N89 (= N100), A90 (≠ V101), I92 (= I103), V139 (≠ I150), S141 (= S152), Y154 (= Y165), K158 (= K169), P184 (= P195), G185 (= G196), I187 (= I198), T189 (= T200), M191 (= M202)
Query Sequence
>AZOBR_RS25420 FitnessBrowser__azobra:AZOBR_RS25420
MSEAKAGRLAGKVALVFGAGSSAPGWGNGKATAVAYAREGARVVAVDKVTEAAEETAALI
AAEGFAALAVTADVTRGPEVAAAVERTLAAHGRIDILHNNVGITEPGGPVETSEESWRRV
LDTDLTGVFLTCKQVLPVMVAQRSGAIVNISSIAAIRWAYPYIGYAAAKAGVNQFTVAVA
RQHARDGIRANAVMPGLIDTPMARSQIAAHYKDAGEMRRARDALCPLGFQGTAWDIAAAS
VFLASDEARYITGVCLPVDGGLSLGIG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory