Comparing AZOBR_RS25580 FitnessBrowser__azobra:AZOBR_RS25580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jb0A Crystal structure of abc transporter alpha-glycoside-binding mutant protein w287a in complex with trehalose (see paper)
45% identity, 89% coverage: 44:423/427 of query aligns to 20:400/404 of 6jb0A
Sites not aligning to the query:
6jahA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with glucose (see paper)
45% identity, 89% coverage: 44:423/427 of query aligns to 20:400/404 of 6jahA
6jagA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose (see paper)
45% identity, 89% coverage: 44:423/427 of query aligns to 20:400/404 of 6jagA
Sites not aligning to the query:
6jadA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with palatinose (see paper)
45% identity, 89% coverage: 44:423/427 of query aligns to 20:400/404 of 6jadA
Sites not aligning to the query:
6j9yA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with maltose (see paper)
45% identity, 89% coverage: 44:423/427 of query aligns to 20:400/404 of 6j9yA
Sites not aligning to the query:
6jamA Crystal structure of abc transporter alpha-glycoside-binding mutant protein r356a in complex with trehalose (see paper)
45% identity, 89% coverage: 44:423/427 of query aligns to 22:402/406 of 6jamA
Sites not aligning to the query:
6jaiA Crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose (see paper)
45% identity, 89% coverage: 44:423/427 of query aligns to 20:400/404 of 6jaiA
Sites not aligning to the query:
6dtqA Maltose bound t. Maritima male3 (see paper)
38% identity, 91% coverage: 30:418/427 of query aligns to 4:387/391 of 6dtqA
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
38% identity, 76% coverage: 79:404/427 of query aligns to 56:387/407 of 1eu8A
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
38% identity, 76% coverage: 79:404/427 of query aligns to 97:428/450 of Q7LYW7
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
34% identity, 82% coverage: 67:418/427 of query aligns to 69:415/416 of A9CEY9
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
34% identity, 82% coverage: 67:418/427 of query aligns to 41:387/389 of 7ofyA
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
34% identity, 82% coverage: 67:415/427 of query aligns to 39:382/384 of 7yzsAAA
Sites not aligning to the query:
7qhvAAA Sulfoquinovosyl binding protein (see paper)
34% identity, 82% coverage: 67:418/427 of query aligns to 40:385/390 of 7qhvAAA
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
35% identity, 82% coverage: 67:418/427 of query aligns to 38:382/382 of 7yzuA
Sites not aligning to the query:
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
26% identity, 91% coverage: 24:413/427 of query aligns to 2:390/399 of 5iaiA
7cafE Mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state (see paper)
27% identity, 84% coverage: 65:424/427 of query aligns to 45:438/443 of 7cafE
Sites not aligning to the query:
G7CES0 Trehalose-binding lipoprotein LpqY; Extracellular solute-binding protein; SugABC transporter substrate-binding protein LpqY; SugABC transporter SBP LpqY from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
26% identity, 89% coverage: 2:379/427 of query aligns to 9:426/471 of G7CES0
7apeA Crystal structure of lpqy from mycobacterium thermoresistible in complex with trehalose (see paper)
26% identity, 74% coverage: 63:379/427 of query aligns to 38:393/435 of 7apeA
Sites not aligning to the query:
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
24% identity, 67% coverage: 120:404/427 of query aligns to 96:373/393 of 5ci5A
Sites not aligning to the query:
>AZOBR_RS25580 FitnessBrowser__azobra:AZOBR_RS25580
MARRWARQCALLLAGMLTAVSALPAAGATVTLACSGLGISFDLCRDGAQEWARRSGNEVR
FVSPPKGASEQLALYQQLLAAGSPDIDVFQIDVVWPGILGNYFIDLKDRAGPDTVGRHLP
AMIEAATVKGRLVAMPWFADAGVLYARKDLLEAHGRPVPQTWEELQDTAALIQRAERAAG
RDRMWGYVWQGRAYEGLTVNALEWIASRNGGTIVAPDGAITIDNPQAAEALAMARGWVGS
ISPPGVLNYMEEEARGVFQSGNAVFMRNWPYAWTLVNAADSAVGGKVAVVPLPKGGPEGR
HTSTLGGQLLAVSKFSAHADEAADLALYLTGLAEQKRRAIHGASNPTIPALYEDAEVVAA
NPFFAALAESIANAVNRPAQATGMRYNQVSAEFYANVHEVLSGRQDAKAMLSDLKEALVR
ISRGGRW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory