Comparing AZOBR_RS25585 FitnessBrowser__azobra:AZOBR_RS25585 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
40% identity, 91% coverage: 12:284/301 of query aligns to 4:270/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
28% identity, 88% coverage: 10:273/301 of query aligns to 24:286/313 of P94529
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
28% identity, 89% coverage: 32:298/301 of query aligns to 258:514/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
29% identity, 84% coverage: 32:283/301 of query aligns to 243:484/490 of 4ki0F
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
25% identity, 58% coverage: 59:234/301 of query aligns to 58:211/281 of P94530
>AZOBR_RS25585 FitnessBrowser__azobra:AZOBR_RS25585
LVSDPRAPSLMRQRRRAAWLFLLPMLIVLAGVAGWPLFRTVFFSFTDATLATLEGFQGVG
LDNYLWLMRDPVWWRAVWNTLVFTVVSVGIETALGLGIALILNAHLPGRGLLRAAVLIPW
AIPTVVSAQMWGWMFHDLYGVVNAILMGLGLIAEPRAWTADPDLALPVVIAVDVWKSTPF
MALLILAALQMLPRDLYEAARVDGVHPVKVFVRITLPLIRPALMVAVLFRTLDALRVFDL
MYVLTGNSRSTMSMSVYARQYLIDFQDVGYGSAAATLLVLVLAVATVLAVTLGRVRVDAG
R
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory