SitesBLAST
Comparing AZOBR_RS25730 FitnessBrowser__azobra:AZOBR_RS25730 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
36% identity, 97% coverage: 1:254/261 of query aligns to 1:239/244 of 7krmC
- active site: G18 (= G16), S140 (= S142), Y155 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S15 (= S15), G18 (= G16), I19 (= I17), D38 (≠ E39), L39 (≠ D40), A60 (= A61), N61 (≠ D62), V62 (= V63), N88 (= N89), V111 (≠ I113), S140 (= S142), Y155 (= Y157), K159 (= K161), I188 (= I190), T190 (= T192)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
38% identity, 97% coverage: 3:254/261 of query aligns to 3:243/248 of 6ixmC
- active site: G16 (= G16), S142 (= S142), Y155 (= Y157), K159 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S15 (= S15), G16 (= G16), I17 (= I17), D36 (≠ S36), I37 (≠ R37), A61 (= A61), D62 (= D62), T63 (≠ V63), N89 (= N89), A90 (= A90), M140 (≠ T140), S142 (= S142), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (≠ G188), Y187 (≠ M189), I188 (= I190), L192 (≠ I194)
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
35% identity, 98% coverage: 3:258/261 of query aligns to 7:251/259 of 6ci9D
- active site: G20 (= G16), S145 (= S142), Y159 (= Y157)
- binding 1-aminopropan-2-one: F97 (≠ N93), S145 (= S142), T147 (≠ N144), W156 (≠ A154), Y159 (= Y157), G190 (= G188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G12), S18 (≠ G14), G20 (= G16), I21 (= I17), G40 (≠ S36), R41 (= R37), N42 (≠ T38), D66 (= D62), V67 (= V63), N93 (= N89), G95 (= G91), T143 (= T140), S145 (= S142), Y159 (= Y157), K163 (= K161), P189 (= P187), N191 (≠ M189), I192 (= I190), T194 (= T192), G196 (≠ I194), L197 (≠ Q195)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
35% identity, 100% coverage: 1:261/261 of query aligns to 1:248/248 of Q9KJF1
- M1 (= M1) modified: Initiator methionine, Removed
- S15 (= S15) binding
- D36 (≠ S36) binding
- D62 (= D62) binding
- I63 (≠ V63) binding
- N89 (= N89) binding
- Y153 (= Y157) binding
- K157 (= K161) binding
5jc8D Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
35% identity, 98% coverage: 3:257/261 of query aligns to 4:258/262 of 5jc8D
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
37% identity, 97% coverage: 3:254/261 of query aligns to 4:244/249 of 4bmsF
- active site: S137 (= S142), H147 (≠ A154), Y150 (= Y157), K154 (= K161), Q195 (≠ T203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), N15 (≠ G14), S16 (= S15), I18 (= I17), R38 (= R37), R39 (≠ T38), A59 (= A61), D60 (= D62), V61 (= V63), N87 (= N89), S88 (≠ A90), G89 (= G91), V110 (≠ I113), S137 (= S142), Y150 (= Y157), K154 (= K161), G181 (= G188), I183 (= I190), T185 (= T192), I187 (= I194)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 99% coverage: 3:261/261 of query aligns to 2:247/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), M16 (≠ I17), D35 (≠ S36), I36 (≠ R37), I62 (≠ V63), N88 (= N89), G90 (= G91), I138 (≠ T140), S140 (= S142), Y152 (= Y157), K156 (= K161), I185 (= I190)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 97% coverage: 1:254/261 of query aligns to 3:250/255 of 5itvA
- active site: G18 (= G16), S141 (= S142), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), S17 (= S15), G18 (= G16), I19 (= I17), D38 (≠ S36), I39 (≠ R37), T61 (≠ A61), I63 (≠ V63), N89 (= N89), G91 (= G91), T139 (= T140), S141 (= S142), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (= G188), I186 (≠ M189), I187 (= I190)
3toxA Crystal structure of a short chain dehydrogenase in complex with NAD(p) from sinorhizobium meliloti 1021
38% identity, 98% coverage: 3:258/261 of query aligns to 3:252/254 of 3toxA
- active site: G16 (= G16), S142 (= S142), V153 (≠ A154), Y156 (= Y157), K160 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), S15 (= S15), G16 (= G16), I17 (= I17), A36 (≠ S36), R37 (= R37), N38 (≠ T38), V63 (= V63), N89 (= N89), A90 (= A90), G91 (= G91), T140 (= T140), S142 (= S142), Y156 (= Y157), K160 (= K161), P186 (= P187), G188 (≠ M189), T189 (≠ I190), T191 (= T192)
6zzpA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and 3-oxovalerate (see paper)
35% identity, 95% coverage: 2:250/261 of query aligns to 7:256/265 of 6zzpA
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), S20 (= S15), G21 (= G16), I22 (= I17), D41 (≠ S36), I42 (≠ R37), M66 (≠ A61), D67 (= D62), V68 (= V63), N94 (= N89), A95 (= A90), G96 (= G91), M145 (≠ T140), S147 (= S142), Y160 (= Y157), K164 (= K161), P190 (= P187), F192 (≠ M189), V193 (≠ I190), T195 (= T192), L197 (≠ I194), V198 (≠ Q195)
- binding 3-oxidanylidenepentanoic acid: Q98 (≠ N93), S147 (= S142), H149 (≠ N144), K157 (≠ A154), Y160 (= Y157), F192 (≠ M189), Q201 (≠ T198)
6zzoC Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and acetoacetate (see paper)
35% identity, 95% coverage: 2:250/261 of query aligns to 7:256/265 of 6zzoC
- binding acetoacetic acid: Q98 (≠ N93), H149 (≠ N144), K157 (≠ A154), F192 (≠ M189), Q201 (≠ T198)
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), S20 (= S15), G21 (= G16), I22 (= I17), D41 (≠ S36), I42 (≠ R37), M66 (≠ A61), D67 (= D62), V68 (= V63), N94 (= N89), A95 (= A90), G96 (= G91), M145 (≠ T140), Y160 (= Y157), K164 (= K161), P190 (= P187), F192 (≠ M189), V193 (≠ I190), T195 (= T192), L197 (≠ I194), V198 (≠ Q195)
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
35% identity, 99% coverage: 1:258/261 of query aligns to 6:253/262 of 3pk0B
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
36% identity, 97% coverage: 3:254/261 of query aligns to 4:244/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S142), H147 (≠ A154), Y150 (= Y157), L188 (≠ I194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), N15 (≠ G14), S16 (= S15), G17 (= G16), I18 (= I17), R38 (= R37), R39 (≠ T38), D60 (= D62), V61 (= V63), N87 (= N89), S88 (≠ A90), G89 (= G91), V110 (≠ I113), T135 (= T140), S137 (= S142), Y150 (= Y157), K154 (= K161), P180 (= P187), G181 (= G188), A182 (≠ M189), I183 (= I190), T185 (= T192), S187 (≠ K193)
Sites not aligning to the query:
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
33% identity, 97% coverage: 3:254/261 of query aligns to 5:256/261 of 6zzsD
- active site: G18 (= G16), S143 (= S142), Y156 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), S17 (= S15), I19 (= I17), D38 (≠ S36), M39 (≠ R37), D64 (= D62), V65 (= V63), N91 (= N89), A92 (= A90), G93 (= G91), M141 (≠ T140), A142 (= A141), S143 (= S142), Y156 (= Y157), K160 (= K161), P186 (= P187), G187 (= G188), V189 (≠ I190), T191 (= T192), L193 (vs. gap)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ N93), S143 (= S142), N145 (= N144), K153 (≠ A154), Y156 (= Y157), Q197 (≠ K193)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
33% identity, 97% coverage: 3:254/261 of query aligns to 4:255/260 of 6zzqA
- active site: G17 (= G16), S142 (= S142), Y155 (= Y157)
- binding acetoacetic acid: Q94 (≠ N93), S142 (= S142), K152 (≠ A154), Y155 (= Y157), Q196 (≠ K193)
- binding nicotinamide-adenine-dinucleotide: G13 (= G12), S16 (= S15), G17 (= G16), I18 (= I17), D37 (≠ S36), M38 (≠ R37), D63 (= D62), V64 (= V63), N90 (= N89), A91 (= A90), G92 (= G91), M140 (≠ T140), A141 (= A141), S142 (= S142), Y155 (= Y157), K159 (= K161), Y187 (≠ M189), V188 (≠ I190), T190 (= T192)
1iy8A Crystal structure of levodione reductase (see paper)
33% identity, 97% coverage: 6:257/261 of query aligns to 5:255/258 of 1iy8A
- active site: G15 (= G16), S143 (= S142), Q153 (≠ A154), Y156 (= Y157), K160 (= K161)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), S14 (= S15), G15 (= G16), L16 (≠ I17), D35 (≠ S36), V36 (≠ R37), A62 (= A61), D63 (= D62), V64 (= V63), N90 (= N89), G92 (= G91), I93 (= I92), T141 (= T140), S143 (= S142), Y156 (= Y157), K160 (= K161), P186 (= P187), G187 (= G188), T191 (= T192), P192 (≠ K193), M193 (≠ I194)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
33% identity, 97% coverage: 6:257/261 of query aligns to 14:264/267 of Q9LBG2
- 17:42 (vs. 9:34, 50% identical) binding
- E103 (≠ N93) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
4nbuB Crystal structure of fabg from bacillus sp (see paper)
33% identity, 97% coverage: 3:254/261 of query aligns to 5:240/244 of 4nbuB
- active site: G18 (= G16), N111 (= N114), S139 (= S142), Q149 (≠ A154), Y152 (= Y157), K156 (= K161)
- binding acetoacetyl-coenzyme a: D93 (≠ W96), K98 (≠ E101), S139 (= S142), N146 (= N151), V147 (≠ A152), Q149 (≠ A154), Y152 (= Y157), F184 (≠ M189), M189 (≠ I194), K200 (≠ Y212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ S15), G18 (= G16), I19 (= I17), D38 (≠ S36), F39 (≠ R37), V59 (≠ A61), D60 (= D62), V61 (= V63), N87 (= N89), A88 (= A90), G89 (= G91), I90 (= I92), T137 (= T140), S139 (= S142), Y152 (= Y157), K156 (= K161), P182 (= P187), F184 (≠ M189), T185 (≠ I190), T187 (= T192), M189 (≠ I194)
A0R518 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 98% coverage: 3:258/261 of query aligns to 5:278/279 of A0R518
- K65 (≠ T50) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
5ej2A Crystal structure of carveol dehydrogenase from mycobacterium avium in complex with NAD (see paper)
31% identity, 98% coverage: 5:259/261 of query aligns to 6:276/277 of 5ej2A
- active site: G17 (= G16), S156 (= S142), Y169 (= Y157), K173 (= K161)
- binding nicotinamide-adenine-dinucleotide: G13 (= G12), R16 (≠ S15), G17 (= G16), Q18 (≠ I17), D37 (≠ S36), I38 (vs. gap), I42 (vs. gap), S50 (≠ R37), D75 (= D62), V76 (= V63), N102 (= N89), A103 (= A90), G104 (= G91), V105 (≠ I92), I126 (= I113), T154 (= T140), S156 (= S142), Y169 (= Y157), K173 (= K161), Q201 (≠ M189), V202 (≠ I190), T204 (= T192), M206 (≠ I194), V207 (≠ Q195)
Query Sequence
>AZOBR_RS25730 FitnessBrowser__azobra:AZOBR_RS25730
MDLNGKVALITGAGSGIGKASATLFASAGASVGVLSRTEDEIRKTAEEITAAGGKAIPLV
ADVADSEAVKRAVDRLVQEYGRLDIVFANAGINGVWAPIDELTPEEWDRTININLRGTYL
TLHHAVPYLKKAGGGSVLVTASINGTRVFSNAGATAYSCTKAAQVAMVQMLALELAKHRI
RVNAICPGMIDTKIQDNTQARNTAEAEEAAEYPDGEIPLTRGKPGSSADVAELALFLASD
RSKHITGTPVWIDGAESLLIG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory