Comparing AZOBR_RS25870 FitnessBrowser__azobra:AZOBR_RS25870 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
51% identity, 93% coverage: 28:505/513 of query aligns to 27:496/501 of 2qcuB
Sites not aligning to the query:
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
51% identity, 92% coverage: 28:500/513 of query aligns to 27:491/495 of 2r46A
Sites not aligning to the query:
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
51% identity, 92% coverage: 28:500/513 of query aligns to 27:491/495 of 2r45A
Sites not aligning to the query:
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
31% identity, 92% coverage: 27:497/513 of query aligns to 41:525/557 of 2rgoA
Sites not aligning to the query:
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 95% coverage: 6:494/513 of query aligns to 75:583/629 of Q9SS48
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
31% identity, 92% coverage: 27:497/513 of query aligns to 39:496/530 of 2rgoB
Sites not aligning to the query:
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
29% identity, 89% coverage: 22:480/513 of query aligns to 36:442/496 of 3da1A
Sites not aligning to the query:
>AZOBR_RS25870 FitnessBrowser__azobra:AZOBR_RS25870
MAGVYDLAIVGGGINGCGIARDAAGRGCSVYLCEQKDLASGTSSASTKLIHGGLRYLEYY
EFRLVREALREREVLWRMAPHIIWPLRFVLPHLPGLRPSWFLRLGLFLYDHLGGREKLPG
TRGLDLRNDPAGKPLKPGFGRAFEYSDCWVDDARLVVLNAQDAARMGATIRTRTRFLNAV
REDGLWTVTVEDTRSGQRSSIRARALVNAAGPWVSEVMRQGARSTVDARIRLVQGSHIVV
PKLFDHDRCYIFQNADKRIVFAIPYERDFTLIGTTDNDYQGDPADVRASEAEIAYLCAAA
GDYFAKPVTPADVVWTYSGVRPLYDDGASTAQAATRDYVLALDAPGDGKAALLNIFGGKI
TTYRRLADAAIAKLAPFLPKLAPGASDWSSAGTLPGGDFPADGVATLISELRGRAPFLTQ
PHLERLARTYGTRARRILDSAARTEDLGRDFGGTLTEAEVRYLMTEEWAETAEDVLWRRT
KLGLRLDAAQAQALDAFMTEERSRRERASDAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory