SitesBLAST
Comparing AZOBR_RS26075 FitnessBrowser__azobra:AZOBR_RS26075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6z1mA Structure of an ancestral glycosidase (family 1) bound to heme (see paper)
46% identity, 97% coverage: 7:438/444 of query aligns to 3:419/423 of 6z1mA
- binding protoporphyrin ix containing fe: P164 (≠ F168), N165 (≠ S169), L194 (≠ V198), L195 (≠ N199), L218 (≠ H222), L220 (≠ R224), N244 (= N248), F247 (= F251), K253 (≠ L257), Y256 (= Y260), L288 (≠ M284), R318 (≠ E336), Y323 (= Y341)
- binding magnesium ion: H346 (≠ V365), K409 (≠ A428)
4ptwA Halothermothrix orenii beta-glucosidase a, 2-deoxy-2-fluoro-glucose complex (see paper)
42% identity, 98% coverage: 6:441/444 of query aligns to 2:444/445 of 4ptwA
- active site: R74 (= R78), H118 (= H122), E163 (= E167), V166 (= V170), N291 (= N290), Y293 (= Y292), E351 (= E349)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q17 (= Q21), H118 (= H122), E163 (= E167), Y293 (= Y292), E351 (= E349), W398 (= W396), E405 (= E403), W406 (= W404)
4ptvA Halothermothrix orenii beta-glucosidase a, thiocellobiose complex (see paper)
42% identity, 98% coverage: 6:441/444 of query aligns to 2:444/445 of 4ptvA
- active site: R74 (= R78), H118 (= H122), E163 (= E167), V166 (= V170), N291 (= N290), Y293 (= Y292), E351 (= E349)
- binding beta-D-glucopyranose: W324 (= W323), E405 (= E403), Y408 (≠ S406)
- binding 4-thio-beta-D-glucopyranose: Q17 (= Q21), H118 (= H122), E163 (= E167), Y293 (= Y292), E351 (= E349), W398 (= W396), E405 (= E403), W406 (= W404)
4hz7A Crystal structure of bglb with glucose (see paper)
44% identity, 97% coverage: 7:437/444 of query aligns to 3:435/441 of 4hz7A
- active site: R74 (= R78), H118 (= H122), E163 (= E167), V166 (= V170), N290 (= N290), Y292 (= Y292), E347 (= E349)
- binding beta-D-glucopyranose: Q17 (= Q21), H118 (= H122), E163 (= E167), Y292 (= Y292), E347 (= E349), W394 (= W396), E401 (= E403), W402 (= W404), F410 (= F412)
2wc3A Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 5:437/442 of 2wc3A
- active site: R76 (= R78), H120 (= H122), E165 (= E167), V168 (= V170), N292 (= N290), Y294 (= Y292), E348 (= E349)
- binding (3Z,5S,6R,7S,8S,8aR)-3-(octylimino)hexahydro[1,3]oxazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q19 (= Q21), H120 (= H122), N164 (= N166), E165 (= E167), Y294 (= Y292), H297 (≠ I295), W321 (= W323), E348 (= E349), W395 (= W396), E402 (= E403), W403 (= W404), F411 (= F412)
1oinA Family 1 b-glucosidase from thermotoga maritima (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 5:437/442 of 1oinA
- active site: R76 (= R78), H120 (= H122), E165 (= E167), V168 (= V170), N292 (= N290), Y294 (= Y292), E348 (= E349)
- binding 2-deoxy-2-fluoro-alpha-D-glucopyranose: Q19 (= Q21), H120 (= H122), N164 (= N166), E165 (= E167), Y294 (= Y292), E348 (= E349), W395 (= W396), E402 (= E403), W403 (= W404)
8ivyA Beta-glucosidase bgla mutant e166q in complex with glucose (see paper)
41% identity, 98% coverage: 4:439/444 of query aligns to 3:445/451 of 8ivyA
5ossB Beta-glucosidase from thermotoga maritima in complex with gluco-1h- imidazole (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 4:438/443 of 5ossB
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (= V170), N291 (= N290), Y293 (= Y292), E349 (= E349)
- binding (4~{S},5~{S},6~{R},7~{R})-7-(hydroxymethyl)-4,5,6,7-tetrahydro-1~{H}-benzimidazole-4,5,6-triol: Q18 (= Q21), H119 (= H122), E164 (= E167), Y293 (= Y292), E349 (= E349), W396 (= W396), E403 (= E403), W404 (= W404), F412 (= F412)
5n6tA Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 4:438/443 of 5n6tA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (= V170), N291 (= N290), Y293 (= Y292), E349 (= E349)
- binding [(1~{R},2~{R},3~{R},4~{S},5~{R},6~{S})-3,4,5-tris(oxidanyl)-7-oxabicyclo[4.1.0]heptan-2-yl]methanediazonium: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y292), E349 (= E349), W396 (= W396), E403 (= E403), W404 (= W404), F412 (= F412)
5n6sA Thermotoga maritima family 1 glycoside hydrolase complexed with carba- cyclophellitol transition state mimic (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 4:438/443 of 5n6sA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (= V170), N291 (= N290), Y293 (= Y292), E349 (= E349)
- binding azanylidene-[4-[[(1~{S},2~{R},3~{R},4~{R},5~{S},6~{S},7~{S})-2-(hydroxymethyl)-3,4,5-tris(oxidanyl)-7-bicyclo[4.1.0]heptanyl]carbonylamino]butylimino]azanium: Q18 (= Q21), H119 (= H122), W120 (= W123), N163 (= N166), E164 (= E167), W166 (≠ S169), V167 (= V170), E349 (= E349), W396 (= W396), E403 (= E403), W404 (= W404), F412 (= F412)
2wc4A Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 4:438/443 of 2wc4A
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (= V170), N291 (= N290), Y293 (= Y292), E349 (= E349)
- binding (3Z,5S,6R,7S,8R,8aS)-3-(octylimino)hexahydro[1,3]thiazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y292), W322 (= W323), E349 (= E349), W396 (= W396), E403 (= E403), W404 (= W404), F412 (= F412)
2wbgA Structure of family 1 beta-glucosidase from thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 4:438/443 of 2wbgA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (= V170), N291 (= N290), Y293 (= Y292), E349 (= E349)
- binding (3Z,5S,6R,7S,8R,8aR)-3-(octylimino)hexahydro[1,3]oxazolo[3,4-a]pyridine-5,6,7,8-tetrol: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y292), H296 (≠ I295), W322 (= W323), E349 (= E349), W396 (= W396), E403 (= E403), W404 (= W404)
1w3jA Family 1 b-glucosidase from thermotoga maritima in complex with tetrahydrooxazine (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 3:437/443 of 1w3jA
- active site: R74 (= R78), H118 (= H122), E163 (= E167), V166 (= V170), N290 (= N290), Y292 (= Y292), E348 (= E349)
- binding tetrahydrooxazine: Q17 (= Q21), H118 (= H122), E163 (= E167), Y292 (= Y292), E348 (= E349), W395 (= W396), E402 (= E403), W403 (= W404)
2jalB Beta-glucosidase from thermotoga maritima in complex with cyclophellitol (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 5:439/444 of 2jalB
- active site: R76 (= R78), H120 (= H122), E165 (= E167), V168 (= V170), N292 (= N290), Y294 (= Y292), E350 (= E349)
- binding calcium ion: D277 (≠ G275), E281 (≠ R279)
- binding (1r,2s,3s,4s,5r,6r)-6-(hydroxymethyl)cyclohexane-1,2,3,4,5-pentol: Q19 (= Q21), H120 (= H122), E165 (= E167), E350 (= E349), W397 (= W396), E404 (= E403), W405 (= W404), F413 (= F412)
1oifA Family 1 b-glucosidase from thermotoga maritima (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 4:438/444 of 1oifA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (= V170), N291 (= N290), Y293 (= Y292), E349 (= E349)
- binding 5-hydroxymethyl-3,4-dihydroxypiperidine: Q18 (= Q21), E164 (= E167), Y293 (= Y292), E349 (= E349), W396 (= W396), E403 (= E403), W404 (= W404), F412 (= F412)
2cesA Beta-glucosidase from thermotoga maritima in complex with glucoimidazole (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 4:435/440 of 2cesA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (= V170), N291 (= N290), Y293 (= Y292), E346 (= E349)
- binding glucoimidazole: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y292), E346 (= E349), W393 (= W396), E400 (= E403), W401 (= W404), F409 (= F412)
2j78A Beta-glucosidase from thermotoga maritima in complex with gluco- hydroximolactam (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 4:437/443 of 2j78A
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (= V170), N291 (= N290), Y293 (= Y292), E348 (= E349)
- binding calcium ion: E64 (≠ A67), E67 (≠ R70), D276 (≠ G275), S279 (≠ A278)
- binding (2s,3s,4r,5r)-6-(hydroxyamino)-2-(hydroxymethyl)-2,3,4,5-tetrahydropyridine-3,4,5-triol: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y293 (= Y292), E348 (= E349), W395 (= W396), E402 (= E403), W403 (= W404), F411 (= F412)
5ns8A Crystal structure of beta-glucosidase bglm-g1 mutant h75r from marine metagenome in complex with inhibitor 1-deoxynojirimycin (see paper)
44% identity, 99% coverage: 3:440/444 of query aligns to 1:440/440 of 5ns8A
2cbvA Beta-glucosidase from thermotoga maritima in complex with calystegine b2 (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 4:437/443 of 2cbvA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (= V170), N290 (= N290), Y292 (= Y292), E348 (= E349)
- binding calystegine b2: Q18 (= Q21), H119 (= H122), W120 (= W123), N163 (= N166), E164 (= E167), E348 (= E349), W395 (= W396), E402 (= E403), W403 (= W404)
1oimA Family 1 b-glucosidase from thermotoga maritima (see paper)
44% identity, 97% coverage: 7:438/444 of query aligns to 4:437/443 of 1oimA
- active site: R75 (= R78), H119 (= H122), E164 (= E167), V167 (= V170), N290 (= N290), Y292 (= Y292), E348 (= E349)
- binding 1-deoxynojirimycin: Q18 (= Q21), H119 (= H122), N163 (= N166), E164 (= E167), Y292 (= Y292), E348 (= E349), W395 (= W396), E402 (= E403), W403 (= W404)
Query Sequence
>AZOBR_RS26075 FitnessBrowser__azobra:AZOBR_RS26075
LEHKAVFPEGFLWGTSTSAFQVEGAATEDGRAPSIWDSFCRLKGRVDNGDTGDVACDHYH
RYAEDVALMRGLGVDAYRFSVAWPRVLPRGRGMANEAGLDFYDRLIDTVLEAGIEPWLCV
YHWDLPQALQDLGGWANRDSAGWYADYTTLLARRYGDRVKRWITFNEFSVFTLFGYAIPW
AAPGITDRGQHLRAIHHVNLAHGAGVDAVRALVPGASIGAVHNRQRVLPEGGKPENAEAA
ALLDEHWNLAFCDPQLLGHYPPRVARAIEPCVKAGDMARICRPMDWFGLNHYGPIFARVN
PETTWGYGWGDAPPDSPTHGVGWAVFPDAFRDELLEITRRYRMPIVITENGCGGSDSPDE
SGDIVDQHRINYLQLYNASMHEAIRGGADVRGYFVWSLLDNFEWGSGYGNRFGIVHVDFE
SQKRTPKASARWYADLIKRARSAT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory