Comparing AZOBR_RS26230 FitnessBrowser__azobra:AZOBR_RS26230 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
42% identity, 77% coverage: 6:256/327 of query aligns to 348:602/611 of 8j5qD
Sites not aligning to the query:
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
42% identity, 77% coverage: 6:256/327 of query aligns to 348:602/608 of 8j5tD
Sites not aligning to the query:
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
42% identity, 77% coverage: 6:256/327 of query aligns to 348:602/608 of 8j5sD
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
36% identity, 90% coverage: 29:322/327 of query aligns to 21:322/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
36% identity, 89% coverage: 29:319/327 of query aligns to 20:308/310 of 4fwiB
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 70% coverage: 29:257/327 of query aligns to 18:245/343 of P30750
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
33% identity, 89% coverage: 29:320/327 of query aligns to 20:324/330 of P0AAH4
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 70% coverage: 29:257/327 of query aligns to 19:246/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 70% coverage: 29:257/327 of query aligns to 19:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 70% coverage: 29:257/327 of query aligns to 19:246/344 of 3tuiC
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
36% identity, 77% coverage: 6:257/327 of query aligns to 3:248/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
38% identity, 70% coverage: 28:257/327 of query aligns to 15:248/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 77% coverage: 6:257/327 of query aligns to 3:248/250 of 7z16I
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
37% identity, 70% coverage: 29:257/327 of query aligns to 14:240/240 of 4ymuJ
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 70% coverage: 28:257/327 of query aligns to 14:240/241 of 4u00A
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
33% identity, 69% coverage: 31:255/327 of query aligns to 21:245/375 of 2d62A
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
32% identity, 72% coverage: 7:243/327 of query aligns to 3:235/280 of Q5M244
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
31% identity, 72% coverage: 19:255/327 of query aligns to 29:265/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
31% identity, 72% coverage: 19:255/327 of query aligns to 29:265/382 of 7aheC
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
33% identity, 65% coverage: 31:244/327 of query aligns to 20:232/353 of 1oxvD
Sites not aligning to the query:
>AZOBR_RS26230 FitnessBrowser__azobra:AZOBR_RS26230
VSTDAVLELRGVSHTYQVRRSPFRKSVPLRAVDDVSLCVHRGEVLGLVGESGCGKSTLSK
ILLGLLPPSSGAVLIDGAAVSGAGQAAFARRVQPVFQDPYSSLNPRKTIAQIIGLPLAVH
GIGDRAGRRQAVTAMLDCVGLPRRVLDTYPKQLSGGQRQRVAIARALIMRPEVVVCDEPT
SALDVSVQAQILNLLTELRRELNLGMLMISHNLAVIEHMATWIAVMYLGRIVESGPTRAI
FERPRHPYTRALLQSVLTTVPGHGIPDPLPGTAIPNPVDRPAGCAFHPRCPLATDLCRTV
PPSRVADARQGGFVECHLFPAGEAEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory